Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067TEP8

Protein Details
Accession A0A067TEP8   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
62-87NTASALDRRGQKRHRRSQDKDQDVEVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11cyto_nucl 11, nucl 7, mito 4, plas 3
Family & Domain DBs
Amino Acid Sequences MFLSVTQIVVALSGAQMHLTVGHELHGPSKLKRRVDSEALQREGRSRNGDPGTTVIGTRRINTASALDRRGQKRHRRSQDKDQDVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.05
4 0.04
5 0.05
6 0.06
7 0.07
8 0.07
9 0.08
10 0.09
11 0.09
12 0.11
13 0.15
14 0.15
15 0.18
16 0.28
17 0.33
18 0.36
19 0.39
20 0.43
21 0.43
22 0.48
23 0.51
24 0.51
25 0.51
26 0.51
27 0.47
28 0.42
29 0.4
30 0.36
31 0.33
32 0.28
33 0.22
34 0.26
35 0.27
36 0.27
37 0.24
38 0.23
39 0.23
40 0.18
41 0.17
42 0.12
43 0.17
44 0.17
45 0.17
46 0.18
47 0.17
48 0.17
49 0.18
50 0.2
51 0.21
52 0.24
53 0.26
54 0.28
55 0.35
56 0.4
57 0.48
58 0.54
59 0.58
60 0.65
61 0.73
62 0.8
63 0.83
64 0.87
65 0.89
66 0.91
67 0.89