FuNGI

A0A067SU96

Protein Details

Accession

A0A067SU96

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
35-56	KGSPAPTTKRSTKPDRDFYSFK	Hydrophilic

NLS Segment(s)

Position	Sequence
32-35	RKLK
218-288	KPQPPPQKPARAVKPLPSRVEAKAPAATPSQPPKVKVPPPAPPAAAAPPPAMAPAPSKAKAAQPKPKKVKP
314-321	SKRARPST
325-328	PPPK

Subcellular Location(s)

cyto_nucl 10.833, cyto 10.5, cyto_mito 9.166, nucl 9, mito 6.5

Family & Domain DBs

InterPro	View protein in InterPro IPR027093 EAF_fam IPR019194 Tscrpt_elong_fac_Eaf_N
Gene Ontology	GO:0032783 C:super elongation complex GO:0006355 P:regulation of DNA-templated transcription
Pfam	View protein in Pfam PF09816 EAF

Amino Acid Sequences

MASSSSSSSWLPAKGRHPVLIGSSLGKVIKNRKLKGSPAPTTKRSTKPDRDFYSFKFNFKASSIDTAKPATIEIKKGAENSRVLAQYPSTQPGEVQLFSGSEQPAKEVDCILIFDEETGTFTLEKLDSFVVLKSEGKKAVSPRPTSPSPAPSVSPNKGKAKQEDYDLDQTMSGLDEDAEGEDDFEEVVPSSAPVKFEEEEEEEGEEIEVPLVQVIRPKPQPPPQKPARAVKPLPSRVEAKAPAATPSQPPKVKVPPPAPPAAAAPPPAMAPAPSKAKAAQPKPKKVKPATPISASIPAPSASYAGEEMEFGKPSKRARPSTPQHPPPKPAPAPRSPVVLSLPAPAPASPVLAPQADTSEDEEDWEQVPTASTAMSQDGNGSTGFDLSLEEELEGDIFGDGFGDAEPYADRDRYGDGDGEEIDENAFAMELDQQMEESEGDVEDDFLAAAVSPEPEQARQPISLNRLASGGGAVGDSDDEFSSSDESDEE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.43
2	0.46
3	0.47
4	0.45
5	0.42
6	0.42
7	0.4
8	0.35
9	0.28
10	0.25
11	0.24
12	0.23
13	0.23
14	0.25
15	0.31
16	0.38
17	0.45
18	0.49
19	0.56
20	0.61
21	0.66
22	0.71
23	0.72
24	0.73
25	0.74
26	0.77
27	0.73
28	0.75
29	0.76
30	0.75
31	0.73
32	0.74
33	0.75
34	0.77
35	0.82
36	0.81
37	0.8
38	0.77
39	0.73
40	0.74
41	0.65
42	0.58
43	0.51
44	0.44
45	0.39
46	0.35
47	0.35
48	0.26
49	0.33
50	0.34
51	0.33
52	0.34
53	0.33
54	0.32
55	0.28
56	0.26
57	0.24
58	0.23
59	0.24
60	0.25
61	0.27
62	0.28
63	0.33
64	0.36
65	0.35
66	0.33
67	0.32
68	0.35
69	0.32
70	0.31
71	0.28
72	0.25
73	0.25
74	0.27
75	0.29
76	0.24
77	0.23
78	0.22
79	0.26
80	0.28
81	0.22
82	0.2
83	0.16
84	0.15
85	0.16
86	0.2
87	0.16
88	0.14
89	0.14
90	0.14
91	0.15
92	0.16
93	0.16
94	0.13
95	0.13
96	0.11
97	0.12
98	0.12
99	0.11
100	0.09
101	0.09
102	0.09
103	0.08
104	0.09
105	0.08
106	0.08
107	0.08
108	0.08
109	0.1
110	0.09
111	0.09
112	0.1
113	0.09
114	0.09
115	0.1
116	0.11
117	0.09
118	0.1
119	0.13
120	0.14
121	0.18
122	0.2
123	0.2
124	0.23
125	0.28
126	0.35
127	0.4
128	0.42
129	0.42
130	0.47
131	0.48
132	0.5
133	0.49
134	0.45
135	0.41
136	0.39
137	0.36
138	0.35
139	0.41
140	0.4
141	0.42
142	0.44
143	0.47
144	0.52
145	0.55
146	0.55
147	0.54
148	0.51
149	0.5
150	0.48
151	0.45
152	0.44
153	0.4
154	0.33
155	0.27
156	0.25
157	0.19
158	0.16
159	0.1
160	0.05
161	0.04
162	0.04
163	0.04
164	0.04
165	0.05
166	0.05
167	0.05
168	0.05
169	0.05
170	0.05
171	0.05
172	0.05
173	0.04
174	0.04
175	0.04
176	0.04
177	0.06
178	0.07
179	0.08
180	0.08
181	0.11
182	0.12
183	0.12
184	0.15
185	0.16
186	0.17
187	0.16
188	0.16
189	0.13
190	0.13
191	0.12
192	0.09
193	0.06
194	0.04
195	0.04
196	0.03
197	0.03
198	0.04
199	0.04
200	0.08
201	0.09
202	0.14
203	0.17
204	0.19
205	0.25
206	0.34
207	0.45
208	0.47
209	0.55
210	0.57
211	0.64
212	0.68
213	0.7
214	0.69
215	0.66
216	0.62
217	0.61
218	0.63
219	0.59
220	0.56
221	0.5
222	0.46
223	0.38
224	0.42
225	0.35
226	0.27
227	0.24
228	0.22
229	0.21
230	0.19
231	0.19
232	0.17
233	0.21
234	0.26
235	0.25
236	0.27
237	0.3
238	0.36
239	0.4
240	0.44
241	0.43
242	0.45
243	0.47
244	0.48
245	0.43
246	0.36
247	0.34
248	0.28
249	0.25
250	0.18
251	0.14
252	0.12
253	0.12
254	0.11
255	0.09
256	0.08
257	0.08
258	0.1
259	0.14
260	0.15
261	0.16
262	0.17
263	0.23
264	0.3
265	0.36
266	0.43
267	0.48
268	0.57
269	0.66
270	0.69
271	0.73
272	0.7
273	0.71
274	0.68
275	0.69
276	0.63
277	0.57
278	0.55
279	0.48
280	0.48
281	0.4
282	0.33
283	0.24
284	0.19
285	0.16
286	0.14
287	0.12
288	0.07
289	0.07
290	0.07
291	0.06
292	0.06
293	0.06
294	0.08
295	0.08
296	0.09
297	0.09
298	0.11
299	0.14
300	0.17
301	0.25
302	0.31
303	0.35
304	0.41
305	0.51
306	0.57
307	0.64
308	0.72
309	0.73
310	0.75
311	0.75
312	0.73
313	0.67
314	0.7
315	0.65
316	0.63
317	0.61
318	0.58
319	0.6
320	0.56
321	0.56
322	0.47
323	0.43
324	0.36
325	0.32
326	0.25
327	0.22
328	0.21
329	0.17
330	0.17
331	0.14
332	0.14
333	0.12
334	0.13
335	0.1
336	0.11
337	0.12
338	0.12
339	0.12
340	0.11
341	0.12
342	0.11
343	0.12
344	0.14
345	0.14
346	0.13
347	0.14
348	0.14
349	0.13
350	0.13
351	0.12
352	0.1
353	0.08
354	0.09
355	0.08
356	0.08
357	0.06
358	0.06
359	0.07
360	0.08
361	0.09
362	0.08
363	0.09
364	0.09
365	0.1
366	0.1
367	0.1
368	0.08
369	0.08
370	0.08
371	0.06
372	0.06
373	0.07
374	0.08
375	0.07
376	0.07
377	0.07
378	0.07
379	0.07
380	0.06
381	0.05
382	0.04
383	0.04
384	0.04
385	0.04
386	0.04
387	0.04
388	0.04
389	0.05
390	0.04
391	0.05
392	0.06
393	0.08
394	0.11
395	0.11
396	0.11
397	0.12
398	0.14
399	0.16
400	0.18
401	0.17
402	0.15
403	0.16
404	0.16
405	0.17
406	0.15
407	0.13
408	0.11
409	0.09
410	0.08
411	0.07
412	0.06
413	0.04
414	0.04
415	0.06
416	0.07
417	0.08
418	0.08
419	0.08
420	0.08
421	0.1
422	0.09
423	0.08
424	0.08
425	0.07
426	0.08
427	0.08
428	0.08
429	0.07
430	0.07
431	0.06
432	0.05
433	0.05
434	0.04
435	0.05
436	0.05
437	0.06
438	0.07
439	0.1
440	0.12
441	0.13
442	0.16
443	0.2
444	0.22
445	0.23
446	0.27
447	0.3
448	0.34
449	0.39
450	0.37
451	0.34
452	0.32
453	0.29
454	0.26
455	0.2
456	0.14
457	0.09
458	0.08
459	0.07
460	0.06
461	0.06
462	0.06
463	0.07
464	0.07
465	0.07
466	0.08
467	0.09
468	0.11
469	0.1

A0A067SU96

3D AlphaFold-predicted Structure Viewer