Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067TTA7

Protein Details
Accession A0A067TTA7    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGKKKRELKRRRKKYRRENPLLPPLPHBasic
NLS Segment(s)
PositionSequence
3-17KKKRELKRRRKKYRR
136-150KRDKANSKLKEGEKK
Subcellular Location(s) nucl 16, mito 6.5, cyto_mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGKKKRELKRRRKKYRRENPLLPPLPHLEAETSQQTKGRCTQNGPERTDIGERCSAPLVLDAGVNRNTDGSGRKRWREDYRLGKDESITDARSLRFDGGNACAGRARGKHTSLMWMQRTDGRTDGWVQDPCMGERKRDKANSKLKEGEKKTRTDEEQGEDKLKESKKGKAEDDEKDTHGVVSDDERLHGDEVVECGAGADELVVVVVEVLGGRAVVEEVLELEDDLGDEKLKLELEETDEKPETRGSPIHPIPQQWLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.96
3 0.96
4 0.95
5 0.93
6 0.92
7 0.92
8 0.88
9 0.78
10 0.71
11 0.63
12 0.56
13 0.47
14 0.38
15 0.3
16 0.24
17 0.27
18 0.29
19 0.27
20 0.25
21 0.28
22 0.27
23 0.28
24 0.34
25 0.38
26 0.35
27 0.38
28 0.47
29 0.54
30 0.61
31 0.62
32 0.57
33 0.51
34 0.5
35 0.51
36 0.42
37 0.37
38 0.34
39 0.3
40 0.28
41 0.28
42 0.25
43 0.19
44 0.2
45 0.16
46 0.11
47 0.12
48 0.11
49 0.13
50 0.15
51 0.15
52 0.13
53 0.12
54 0.12
55 0.13
56 0.18
57 0.2
58 0.28
59 0.35
60 0.4
61 0.45
62 0.52
63 0.59
64 0.6
65 0.64
66 0.65
67 0.66
68 0.66
69 0.63
70 0.56
71 0.48
72 0.43
73 0.38
74 0.3
75 0.22
76 0.18
77 0.18
78 0.18
79 0.18
80 0.18
81 0.15
82 0.12
83 0.12
84 0.12
85 0.12
86 0.17
87 0.16
88 0.15
89 0.15
90 0.15
91 0.17
92 0.17
93 0.19
94 0.18
95 0.2
96 0.22
97 0.22
98 0.27
99 0.28
100 0.34
101 0.31
102 0.28
103 0.27
104 0.28
105 0.29
106 0.24
107 0.22
108 0.15
109 0.14
110 0.15
111 0.16
112 0.16
113 0.15
114 0.15
115 0.17
116 0.17
117 0.17
118 0.24
119 0.22
120 0.22
121 0.27
122 0.31
123 0.34
124 0.41
125 0.45
126 0.46
127 0.56
128 0.57
129 0.58
130 0.61
131 0.59
132 0.61
133 0.62
134 0.62
135 0.57
136 0.56
137 0.54
138 0.52
139 0.5
140 0.46
141 0.44
142 0.38
143 0.39
144 0.37
145 0.35
146 0.3
147 0.28
148 0.29
149 0.27
150 0.3
151 0.27
152 0.32
153 0.36
154 0.42
155 0.44
156 0.46
157 0.51
158 0.49
159 0.53
160 0.49
161 0.44
162 0.4
163 0.37
164 0.28
165 0.23
166 0.18
167 0.11
168 0.11
169 0.14
170 0.12
171 0.13
172 0.14
173 0.14
174 0.15
175 0.14
176 0.13
177 0.09
178 0.1
179 0.1
180 0.09
181 0.07
182 0.07
183 0.06
184 0.05
185 0.04
186 0.03
187 0.03
188 0.03
189 0.03
190 0.02
191 0.02
192 0.02
193 0.02
194 0.02
195 0.02
196 0.02
197 0.02
198 0.02
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.04
206 0.05
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.06
213 0.06
214 0.06
215 0.06
216 0.07
217 0.08
218 0.09
219 0.09
220 0.09
221 0.1
222 0.16
223 0.23
224 0.24
225 0.29
226 0.31
227 0.31
228 0.31
229 0.32
230 0.28
231 0.25
232 0.28
233 0.26
234 0.34
235 0.38
236 0.45
237 0.45
238 0.46