Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067T214

Protein Details
Accession A0A067T214    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
90-115KPTPSAHPGKRKPQIFKSNRNDTDRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MTMTQVWQIKSSQQNSPIDASLLVTRIDNAQQSYMQSRTPQAQLNPPTPVLVLAHRASAYSLSKNPTCPNHHRATPLSRDPLAEQLEEPKPTPSAHPGKRKPQIFKSNRNDTDRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.47
4 0.4
5 0.32
6 0.28
7 0.24
8 0.18
9 0.16
10 0.13
11 0.1
12 0.1
13 0.11
14 0.12
15 0.13
16 0.12
17 0.13
18 0.13
19 0.15
20 0.18
21 0.18
22 0.18
23 0.17
24 0.18
25 0.2
26 0.22
27 0.23
28 0.22
29 0.29
30 0.32
31 0.33
32 0.33
33 0.3
34 0.28
35 0.24
36 0.22
37 0.15
38 0.12
39 0.12
40 0.11
41 0.11
42 0.11
43 0.11
44 0.1
45 0.11
46 0.12
47 0.1
48 0.12
49 0.14
50 0.15
51 0.17
52 0.21
53 0.25
54 0.3
55 0.35
56 0.4
57 0.41
58 0.43
59 0.45
60 0.46
61 0.46
62 0.47
63 0.45
64 0.43
65 0.39
66 0.38
67 0.35
68 0.36
69 0.32
70 0.26
71 0.21
72 0.22
73 0.25
74 0.25
75 0.25
76 0.2
77 0.2
78 0.2
79 0.22
80 0.26
81 0.32
82 0.4
83 0.5
84 0.57
85 0.66
86 0.74
87 0.79
88 0.79
89 0.79
90 0.82
91 0.81
92 0.83
93 0.83
94 0.85
95 0.85
96 0.83