Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067SY92

Protein Details
Accession A0A067SY92    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-67GKDSRPSYFIRPKARRQHREBasic
NLS Segment(s)
Subcellular Location(s) plas 19, mito 3, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANRDSGVPGGQFLSIASVRCMEWASVSLLVALSYLVSGIIDYISGFGKDSRPSYFIRPKARRQHRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.11
5 0.11
6 0.11
7 0.12
8 0.13
9 0.09
10 0.08
11 0.09
12 0.1
13 0.09
14 0.09
15 0.08
16 0.08
17 0.07
18 0.07
19 0.05
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.04
32 0.04
33 0.05
34 0.06
35 0.09
36 0.12
37 0.14
38 0.16
39 0.19
40 0.21
41 0.3
42 0.39
43 0.44
44 0.53
45 0.59
46 0.66
47 0.75