Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067U0T5

Protein Details
Accession A0A067U0T5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
338-357IMNCRSLFARKQRRRGELVFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR022057  Chs7  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12271  Chs7  
Amino Acid Sequences MVNFGDFKPLCSDTPSYPWCNLFYRQLQRASSGTLKGLSLPTVSAPVGVNPTCGILRAGQHGSIGNVANIAACGVSMILVMFLIFICNRRKAAVGRIELRTFLTLYLLTLPLQLITTGSFLEQGSTPLVAITAVHVGAVVALFWSLLANAIVATQVVEDGTLSSLVPFHIFTLITLGVGIYISLDIALGVTDVIGGVSSPPESLRSIALFVLTSIWPGVCAILYLGIMSYIVLHVLNETRPMWYYILAACLFVLSQLAWFLLGRVICKGSNSKIDGSFVATLLETAAVGVLYLAWKSITEGTSSCFRPFSIVYWGFGSTSSDRSIVAMAMNKYDCVVIMNCRSLFARKQRRRGELVFPSPKFVVIFAYSTSTDLRLFFNRIMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.39
4 0.4
5 0.42
6 0.41
7 0.42
8 0.42
9 0.41
10 0.45
11 0.5
12 0.53
13 0.57
14 0.55
15 0.54
16 0.51
17 0.49
18 0.44
19 0.37
20 0.33
21 0.28
22 0.26
23 0.25
24 0.24
25 0.2
26 0.16
27 0.14
28 0.13
29 0.14
30 0.14
31 0.13
32 0.12
33 0.13
34 0.17
35 0.17
36 0.17
37 0.14
38 0.17
39 0.15
40 0.15
41 0.15
42 0.12
43 0.14
44 0.19
45 0.21
46 0.19
47 0.2
48 0.2
49 0.2
50 0.2
51 0.18
52 0.13
53 0.11
54 0.1
55 0.09
56 0.08
57 0.08
58 0.04
59 0.03
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.05
72 0.09
73 0.13
74 0.16
75 0.17
76 0.18
77 0.22
78 0.23
79 0.32
80 0.36
81 0.39
82 0.42
83 0.45
84 0.45
85 0.42
86 0.41
87 0.33
88 0.25
89 0.19
90 0.14
91 0.1
92 0.1
93 0.11
94 0.1
95 0.09
96 0.09
97 0.09
98 0.08
99 0.08
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07
108 0.08
109 0.08
110 0.08
111 0.08
112 0.08
113 0.08
114 0.07
115 0.07
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.04
123 0.04
124 0.04
125 0.04
126 0.03
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.05
156 0.06
157 0.06
158 0.06
159 0.08
160 0.08
161 0.07
162 0.07
163 0.06
164 0.05
165 0.05
166 0.05
167 0.02
168 0.02
169 0.02
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.03
186 0.03
187 0.03
188 0.05
189 0.06
190 0.07
191 0.07
192 0.08
193 0.08
194 0.08
195 0.09
196 0.07
197 0.07
198 0.08
199 0.07
200 0.06
201 0.06
202 0.05
203 0.05
204 0.05
205 0.05
206 0.03
207 0.03
208 0.03
209 0.04
210 0.04
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.02
218 0.03
219 0.03
220 0.03
221 0.04
222 0.05
223 0.06
224 0.08
225 0.08
226 0.08
227 0.09
228 0.12
229 0.11
230 0.11
231 0.12
232 0.1
233 0.13
234 0.13
235 0.12
236 0.1
237 0.09
238 0.08
239 0.07
240 0.07
241 0.03
242 0.03
243 0.04
244 0.04
245 0.04
246 0.04
247 0.05
248 0.07
249 0.07
250 0.08
251 0.09
252 0.11
253 0.1
254 0.13
255 0.16
256 0.17
257 0.23
258 0.25
259 0.27
260 0.26
261 0.28
262 0.26
263 0.26
264 0.23
265 0.17
266 0.15
267 0.12
268 0.1
269 0.09
270 0.08
271 0.05
272 0.04
273 0.04
274 0.03
275 0.03
276 0.03
277 0.03
278 0.03
279 0.03
280 0.04
281 0.04
282 0.04
283 0.06
284 0.09
285 0.1
286 0.11
287 0.12
288 0.14
289 0.2
290 0.22
291 0.22
292 0.19
293 0.19
294 0.21
295 0.21
296 0.21
297 0.25
298 0.25
299 0.25
300 0.26
301 0.27
302 0.24
303 0.23
304 0.24
305 0.16
306 0.18
307 0.17
308 0.16
309 0.16
310 0.16
311 0.16
312 0.13
313 0.13
314 0.16
315 0.15
316 0.19
317 0.2
318 0.19
319 0.19
320 0.18
321 0.16
322 0.13
323 0.14
324 0.16
325 0.2
326 0.26
327 0.25
328 0.27
329 0.29
330 0.3
331 0.37
332 0.42
333 0.49
334 0.53
335 0.63
336 0.71
337 0.77
338 0.81
339 0.78
340 0.77
341 0.76
342 0.78
343 0.77
344 0.68
345 0.66
346 0.58
347 0.54
348 0.44
349 0.34
350 0.28
351 0.2
352 0.21
353 0.17
354 0.21
355 0.2
356 0.21
357 0.22
358 0.19
359 0.18
360 0.18
361 0.2
362 0.21
363 0.24