Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067T1F4

Protein Details
Accession A0A067T1F4    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-29TYIPIQKINYRDRKKRGMTRLNGALAHydrophilic
57-77VGGIVRRRRRGRQANRNPATPHydrophilic
NLS Segment(s)
PositionSequence
62-68RRRRRGR
Subcellular Location(s) mito 15, plas 3, extr 3, cyto_nucl 3, nucl 2.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MIATYIPIQKINYRDRKKRGMTRLNGALASERFIRRAVASATSAWVGCGRETAKSDVGGIVRRRRRGRQANRNPATPEQVLLLVVLVALVACELQVQLHAGRHLRSRTGEASRAALAHCLHPEARHQKWRSRLARARACGGSGSGGGDGDEMNLGLGSGAACARPDGVVAASEAFHERRCFSRRRRSGGAEGIES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.78
4 0.83
5 0.85
6 0.86
7 0.85
8 0.82
9 0.81
10 0.8
11 0.73
12 0.64
13 0.54
14 0.48
15 0.38
16 0.33
17 0.29
18 0.22
19 0.2
20 0.2
21 0.21
22 0.17
23 0.21
24 0.2
25 0.18
26 0.19
27 0.18
28 0.19
29 0.18
30 0.17
31 0.14
32 0.14
33 0.12
34 0.1
35 0.13
36 0.12
37 0.14
38 0.17
39 0.2
40 0.19
41 0.19
42 0.19
43 0.18
44 0.19
45 0.23
46 0.25
47 0.31
48 0.35
49 0.42
50 0.47
51 0.52
52 0.61
53 0.66
54 0.72
55 0.74
56 0.8
57 0.84
58 0.82
59 0.79
60 0.72
61 0.63
62 0.57
63 0.46
64 0.35
65 0.24
66 0.21
67 0.16
68 0.12
69 0.1
70 0.05
71 0.04
72 0.04
73 0.02
74 0.02
75 0.02
76 0.02
77 0.01
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.03
84 0.04
85 0.05
86 0.07
87 0.08
88 0.1
89 0.14
90 0.15
91 0.16
92 0.16
93 0.19
94 0.21
95 0.24
96 0.26
97 0.23
98 0.23
99 0.22
100 0.21
101 0.18
102 0.16
103 0.14
104 0.12
105 0.12
106 0.12
107 0.11
108 0.12
109 0.19
110 0.24
111 0.29
112 0.36
113 0.39
114 0.44
115 0.52
116 0.62
117 0.6
118 0.64
119 0.66
120 0.67
121 0.72
122 0.69
123 0.65
124 0.55
125 0.51
126 0.4
127 0.33
128 0.24
129 0.16
130 0.14
131 0.09
132 0.08
133 0.07
134 0.07
135 0.06
136 0.05
137 0.05
138 0.04
139 0.04
140 0.04
141 0.03
142 0.03
143 0.03
144 0.03
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.06
151 0.06
152 0.06
153 0.06
154 0.07
155 0.07
156 0.08
157 0.08
158 0.08
159 0.09
160 0.12
161 0.12
162 0.14
163 0.16
164 0.18
165 0.24
166 0.3
167 0.38
168 0.46
169 0.56
170 0.62
171 0.69
172 0.76
173 0.76
174 0.79
175 0.79