Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067T902

Protein Details
Accession A0A067T902    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
69-91DERERLARIKKHQERERRRQAQGBasic
NLS Segment(s)
PositionSequence
48-52RRGVK
57-105VEKRVRWRSNAIDERERLARIKKHQERERRRQAQGIREREKTPGRRRAG
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, cyto 7.5, mito 4, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNRDEREEPGTKEVENAKGKSLNLTIEMLTKERGTKNQEDEKKLREVRRGVKWTDGVEKRVRWRSNAIDERERLARIKKHQERERRRQAQGIREREKTPGRRRAGIRENWWQASKNSLWEPAYVVRSFLITAINIALDTFHIDQHTQHPQMPLSMASSLLETLAAPYTTQEHNALLPFLLVCEAMPGMRKDKKLCLAACFVWLSVCVPPVVLTSLNLTDDDVAVVLEDLKEGAISCYFAARAALRPQFFRSIPRDPPITAYMYSFRFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.39
4 0.39
5 0.41
6 0.41
7 0.4
8 0.38
9 0.31
10 0.26
11 0.27
12 0.23
13 0.23
14 0.24
15 0.21
16 0.2
17 0.19
18 0.22
19 0.24
20 0.29
21 0.33
22 0.38
23 0.45
24 0.54
25 0.61
26 0.64
27 0.65
28 0.64
29 0.66
30 0.66
31 0.63
32 0.61
33 0.62
34 0.62
35 0.67
36 0.69
37 0.62
38 0.61
39 0.59
40 0.54
41 0.55
42 0.51
43 0.46
44 0.45
45 0.48
46 0.5
47 0.56
48 0.55
49 0.48
50 0.51
51 0.53
52 0.57
53 0.61
54 0.59
55 0.57
56 0.56
57 0.56
58 0.52
59 0.46
60 0.38
61 0.36
62 0.37
63 0.38
64 0.48
65 0.53
66 0.61
67 0.68
68 0.76
69 0.8
70 0.85
71 0.88
72 0.85
73 0.79
74 0.76
75 0.74
76 0.73
77 0.72
78 0.71
79 0.65
80 0.61
81 0.59
82 0.58
83 0.6
84 0.59
85 0.6
86 0.59
87 0.57
88 0.6
89 0.62
90 0.66
91 0.66
92 0.63
93 0.59
94 0.59
95 0.59
96 0.54
97 0.53
98 0.45
99 0.36
100 0.34
101 0.29
102 0.23
103 0.2
104 0.21
105 0.2
106 0.19
107 0.21
108 0.19
109 0.21
110 0.17
111 0.16
112 0.13
113 0.12
114 0.12
115 0.11
116 0.08
117 0.05
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.03
125 0.05
126 0.05
127 0.06
128 0.06
129 0.07
130 0.08
131 0.12
132 0.18
133 0.17
134 0.19
135 0.2
136 0.2
137 0.2
138 0.2
139 0.16
140 0.11
141 0.1
142 0.08
143 0.07
144 0.07
145 0.06
146 0.06
147 0.05
148 0.04
149 0.04
150 0.05
151 0.05
152 0.04
153 0.05
154 0.08
155 0.08
156 0.1
157 0.1
158 0.1
159 0.11
160 0.12
161 0.12
162 0.09
163 0.08
164 0.07
165 0.06
166 0.06
167 0.05
168 0.04
169 0.04
170 0.04
171 0.05
172 0.07
173 0.09
174 0.14
175 0.19
176 0.23
177 0.25
178 0.31
179 0.38
180 0.42
181 0.43
182 0.41
183 0.41
184 0.38
185 0.38
186 0.33
187 0.26
188 0.19
189 0.17
190 0.15
191 0.11
192 0.11
193 0.08
194 0.07
195 0.08
196 0.09
197 0.1
198 0.09
199 0.09
200 0.11
201 0.12
202 0.13
203 0.13
204 0.12
205 0.11
206 0.1
207 0.1
208 0.07
209 0.05
210 0.05
211 0.05
212 0.05
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.05
219 0.06
220 0.06
221 0.07
222 0.07
223 0.09
224 0.09
225 0.09
226 0.11
227 0.11
228 0.16
229 0.23
230 0.29
231 0.3
232 0.33
233 0.36
234 0.41
235 0.4
236 0.43
237 0.42
238 0.44
239 0.48
240 0.51
241 0.51
242 0.45
243 0.49
244 0.45
245 0.42
246 0.35
247 0.32
248 0.31