Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MNK0

Protein Details
Accession A0A067MNK0   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-39MPKDAKPKRKAAEKAEKVAKPKAKKEKDPSAPKKPRSPFBasic
NLS Segment(s)
PositionSequence
5-36AKPKRKAAEKAEKVAKPKAKKEKDPSAPKKPR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPKDAKPKRKAAEKAEKVAKPKAKKEKDPSAPKKPRSPFLFFCSDWRERIKAENPDAKFGDLGKLLGAKWKELAGDEKKTYTKQAAEDKTRYEEEMEAYRSKPEEGSGGEQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.76
4 0.7
5 0.71
6 0.68
7 0.65
8 0.67
9 0.69
10 0.69
11 0.75
12 0.79
13 0.81
14 0.83
15 0.87
16 0.86
17 0.86
18 0.87
19 0.83
20 0.83
21 0.77
22 0.76
23 0.71
24 0.69
25 0.62
26 0.58
27 0.58
28 0.49
29 0.48
30 0.46
31 0.42
32 0.37
33 0.35
34 0.31
35 0.25
36 0.3
37 0.32
38 0.32
39 0.36
40 0.4
41 0.38
42 0.4
43 0.4
44 0.35
45 0.29
46 0.22
47 0.19
48 0.12
49 0.12
50 0.08
51 0.08
52 0.08
53 0.12
54 0.12
55 0.1
56 0.11
57 0.11
58 0.11
59 0.11
60 0.19
61 0.19
62 0.25
63 0.26
64 0.28
65 0.29
66 0.3
67 0.32
68 0.29
69 0.27
70 0.28
71 0.36
72 0.42
73 0.47
74 0.49
75 0.49
76 0.5
77 0.48
78 0.43
79 0.36
80 0.29
81 0.25
82 0.27
83 0.28
84 0.25
85 0.25
86 0.27
87 0.26
88 0.25
89 0.23
90 0.18
91 0.19
92 0.21