Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067M5Z8

Protein Details
Accession A0A067M5Z8   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-35APTSSGGKSAKKKKWSKGKVKDKAQHAVTHydrophilic
NLS Segment(s)
PositionSequence
10-29SSGGKSAKKKKWSKGKVKDK
Subcellular Location(s) nucl 16, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPTSSGGKSAKKKKWSKGKVKDKAQHAVTLDKPTYDRIIREVPGFRFVSQSILIERLKINGSLARIAIRHLEKEGQIKRIVHHHGQLIYTRSTAAAGAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.54
3 0.59
4 0.63
5 0.7
6 0.72
7 0.81
8 0.84
9 0.86
10 0.87
11 0.9
12 0.9
13 0.92
14 0.89
15 0.84
16 0.82
17 0.72
18 0.65
19 0.56
20 0.51
21 0.43
22 0.41
23 0.34
24 0.27
25 0.26
26 0.23
27 0.25
28 0.21
29 0.18
30 0.17
31 0.2
32 0.2
33 0.22
34 0.24
35 0.21
36 0.25
37 0.25
38 0.22
39 0.2
40 0.19
41 0.18
42 0.15
43 0.15
44 0.11
45 0.13
46 0.13
47 0.13
48 0.13
49 0.12
50 0.13
51 0.12
52 0.12
53 0.11
54 0.12
55 0.12
56 0.12
57 0.12
58 0.12
59 0.12
60 0.17
61 0.16
62 0.16
63 0.17
64 0.2
65 0.2
66 0.29
67 0.32
68 0.31
69 0.34
70 0.34
71 0.35
72 0.4
73 0.44
74 0.39
75 0.4
76 0.41
77 0.38
78 0.39
79 0.41
80 0.37
81 0.32
82 0.28
83 0.25
84 0.2
85 0.18