Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067M6W4

Protein Details
Accession A0A067M6W4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
270-299RSPLLPCQPLRPRRRSRRLSTPRRLQLRAPHydrophilic
NLS Segment(s)
PositionSequence
280-304RPRRRSRRLSTPRRLQLRAPRPRLL
Subcellular Location(s) plas 12, mito 11, E.R. 2
Family & Domain DBs
Amino Acid Sequences MLPVDNPKAQGIDLNFGVVDAAVRRPPFSPFLPLVSSLQKFASKTCVSPFLSWPSSASPHSLSPMPPKTHPTLLVPSLSPSASPSGLSSSDRILTLIPPIQALDPMILIARIPMPAILTALILTPPTPRIPTLRIPMPVIPIALIPMPAIPTFLMLATPMVAIPIPRILTLRIPIPLILIPRTPTLRIPIPLILIPRTPTLRIPTLLILMILIRPIPTPRIPTPLILWILIPPTPLTPTPPTPTLLLLPRTLCPPPLPRPLLHRLLLPPRSPLLPCQPLRPRRRSRRLSTPRRLQLRAPRPRLLRCPPTAPRSRAAMARSRSPSSVSSLLLFSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.18
4 0.17
5 0.12
6 0.11
7 0.07
8 0.1
9 0.13
10 0.14
11 0.16
12 0.17
13 0.2
14 0.24
15 0.25
16 0.29
17 0.28
18 0.31
19 0.32
20 0.33
21 0.33
22 0.35
23 0.34
24 0.28
25 0.29
26 0.28
27 0.26
28 0.25
29 0.31
30 0.26
31 0.27
32 0.29
33 0.34
34 0.34
35 0.36
36 0.39
37 0.38
38 0.38
39 0.37
40 0.34
41 0.3
42 0.31
43 0.29
44 0.28
45 0.23
46 0.22
47 0.24
48 0.25
49 0.23
50 0.29
51 0.36
52 0.37
53 0.37
54 0.41
55 0.43
56 0.45
57 0.45
58 0.4
59 0.38
60 0.37
61 0.36
62 0.31
63 0.29
64 0.26
65 0.24
66 0.19
67 0.14
68 0.14
69 0.12
70 0.12
71 0.11
72 0.12
73 0.14
74 0.15
75 0.15
76 0.14
77 0.15
78 0.14
79 0.14
80 0.12
81 0.11
82 0.13
83 0.14
84 0.13
85 0.12
86 0.12
87 0.12
88 0.12
89 0.12
90 0.09
91 0.06
92 0.06
93 0.06
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.07
113 0.08
114 0.09
115 0.09
116 0.12
117 0.16
118 0.21
119 0.26
120 0.28
121 0.29
122 0.3
123 0.3
124 0.29
125 0.26
126 0.21
127 0.16
128 0.11
129 0.11
130 0.09
131 0.08
132 0.05
133 0.05
134 0.06
135 0.05
136 0.06
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.04
146 0.03
147 0.03
148 0.03
149 0.03
150 0.04
151 0.05
152 0.05
153 0.06
154 0.06
155 0.07
156 0.08
157 0.1
158 0.11
159 0.1
160 0.1
161 0.09
162 0.1
163 0.1
164 0.1
165 0.1
166 0.1
167 0.1
168 0.12
169 0.13
170 0.13
171 0.13
172 0.15
173 0.17
174 0.17
175 0.18
176 0.17
177 0.17
178 0.18
179 0.18
180 0.15
181 0.13
182 0.13
183 0.13
184 0.13
185 0.13
186 0.14
187 0.17
188 0.18
189 0.18
190 0.18
191 0.17
192 0.17
193 0.16
194 0.14
195 0.1
196 0.08
197 0.07
198 0.06
199 0.05
200 0.04
201 0.05
202 0.06
203 0.09
204 0.11
205 0.16
206 0.18
207 0.24
208 0.24
209 0.25
210 0.26
211 0.28
212 0.28
213 0.22
214 0.21
215 0.16
216 0.16
217 0.15
218 0.13
219 0.09
220 0.08
221 0.1
222 0.1
223 0.14
224 0.17
225 0.21
226 0.24
227 0.26
228 0.27
229 0.25
230 0.27
231 0.26
232 0.26
233 0.25
234 0.23
235 0.23
236 0.22
237 0.25
238 0.24
239 0.22
240 0.21
241 0.26
242 0.3
243 0.38
244 0.4
245 0.39
246 0.46
247 0.52
248 0.54
249 0.48
250 0.45
251 0.41
252 0.48
253 0.51
254 0.45
255 0.41
256 0.37
257 0.38
258 0.36
259 0.34
260 0.34
261 0.38
262 0.38
263 0.45
264 0.52
265 0.6
266 0.69
267 0.74
268 0.76
269 0.78
270 0.88
271 0.89
272 0.87
273 0.89
274 0.91
275 0.91
276 0.91
277 0.91
278 0.89
279 0.87
280 0.82
281 0.79
282 0.79
283 0.78
284 0.78
285 0.75
286 0.73
287 0.72
288 0.77
289 0.78
290 0.77
291 0.75
292 0.7
293 0.72
294 0.72
295 0.75
296 0.76
297 0.71
298 0.66
299 0.63
300 0.61
301 0.57
302 0.54
303 0.53
304 0.48
305 0.53
306 0.54
307 0.52
308 0.49
309 0.48
310 0.44
311 0.42
312 0.41
313 0.33
314 0.29