Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067LZY2

Protein Details
Accession A0A067LZY2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
450-469VELRKERGDRPPSRPRNVPPBasic
NLS Segment(s)
PositionSequence
453-495RKERGDRPPSRPRNVPPPNGEMRGGYRGGRGAGGGGRGRGIPK
Subcellular Location(s) mito 13.5, cyto_mito 12.166, cyto 9.5, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR032710  NTF2-like_dom_sf  
IPR002075  NTF2_dom  
IPR018222  Nuclear_transport_factor_2_euk  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR039539  Ras_GTPase_bind_prot  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043229  C:intracellular organelle  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF02136  NTF2  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50177  NTF2_DOMAIN  
PS50102  RRM  
CDD cd00780  NTF2  
cd00590  RRM_SF  
Amino Acid Sequences MTTTNPNQSGAPSATPTKVVPSEVGWQFVPQYYTFVNKQPHRLHCFYTKNSTFIHGTEGEDGKPCYGQQEIHNKILSIGFQDCKVFIHSVDAQSSANGGIIIQVIGEMSNNGDPWRKFAQTFFLAEQPNGYFVLNDIFRFLKEETAGDEESVEEGAEEPAQQDTSHPPNASTYAETLVTPEAQPAPPAAPVEPAPAAEPTPEPPAVTLAPEPAPPAAALSNGVHAEPEEPPAVDSAAEPEVEQVSTPAPAPVALSSRPATPPPAEAPEAPEPAPVPAPAPISVSSPAPPAPVQVPAPTPAPAPRPPQPKTWANLAASNSNKWGAQVAQDAKGVSAAPPAPPSPAPIPPKSGSPAPRDGQHPAAAAAFAITTPQCFVKNVLESVATNALRDTLTNRFGPVKELDVVRSKACAFLEFNTVEAARRAILASLPLAQGGEGGIKVGEEGVRITVELRKERGDRPPSRPRNVPPPNGEMRGGYRGGRGAGGGGRGRGIPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.27
4 0.28
5 0.27
6 0.26
7 0.24
8 0.23
9 0.31
10 0.31
11 0.33
12 0.27
13 0.26
14 0.26
15 0.27
16 0.26
17 0.18
18 0.2
19 0.18
20 0.23
21 0.25
22 0.3
23 0.37
24 0.4
25 0.49
26 0.55
27 0.63
28 0.66
29 0.67
30 0.66
31 0.66
32 0.7
33 0.66
34 0.68
35 0.61
36 0.55
37 0.53
38 0.52
39 0.44
40 0.35
41 0.35
42 0.26
43 0.25
44 0.27
45 0.28
46 0.24
47 0.25
48 0.25
49 0.21
50 0.2
51 0.18
52 0.15
53 0.15
54 0.17
55 0.22
56 0.33
57 0.37
58 0.41
59 0.43
60 0.4
61 0.4
62 0.38
63 0.31
64 0.23
65 0.22
66 0.18
67 0.18
68 0.19
69 0.18
70 0.17
71 0.2
72 0.17
73 0.13
74 0.18
75 0.2
76 0.22
77 0.23
78 0.23
79 0.2
80 0.19
81 0.2
82 0.14
83 0.11
84 0.08
85 0.06
86 0.06
87 0.06
88 0.06
89 0.05
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.06
97 0.07
98 0.08
99 0.14
100 0.14
101 0.19
102 0.24
103 0.25
104 0.25
105 0.26
106 0.32
107 0.3
108 0.33
109 0.3
110 0.31
111 0.3
112 0.29
113 0.29
114 0.22
115 0.19
116 0.17
117 0.15
118 0.09
119 0.08
120 0.13
121 0.12
122 0.12
123 0.13
124 0.12
125 0.12
126 0.16
127 0.16
128 0.13
129 0.13
130 0.14
131 0.14
132 0.18
133 0.18
134 0.15
135 0.15
136 0.12
137 0.12
138 0.11
139 0.09
140 0.04
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.06
148 0.06
149 0.07
150 0.12
151 0.17
152 0.2
153 0.2
154 0.2
155 0.21
156 0.23
157 0.23
158 0.19
159 0.15
160 0.13
161 0.13
162 0.13
163 0.12
164 0.11
165 0.1
166 0.09
167 0.09
168 0.1
169 0.09
170 0.1
171 0.1
172 0.1
173 0.1
174 0.11
175 0.1
176 0.1
177 0.1
178 0.12
179 0.11
180 0.11
181 0.11
182 0.1
183 0.1
184 0.1
185 0.1
186 0.09
187 0.12
188 0.12
189 0.11
190 0.11
191 0.13
192 0.12
193 0.13
194 0.11
195 0.1
196 0.1
197 0.1
198 0.11
199 0.09
200 0.09
201 0.07
202 0.08
203 0.06
204 0.06
205 0.07
206 0.07
207 0.08
208 0.08
209 0.08
210 0.07
211 0.07
212 0.08
213 0.07
214 0.09
215 0.08
216 0.07
217 0.08
218 0.08
219 0.08
220 0.07
221 0.06
222 0.06
223 0.07
224 0.07
225 0.06
226 0.07
227 0.07
228 0.07
229 0.07
230 0.05
231 0.05
232 0.05
233 0.05
234 0.05
235 0.04
236 0.05
237 0.05
238 0.06
239 0.07
240 0.07
241 0.1
242 0.1
243 0.12
244 0.13
245 0.13
246 0.14
247 0.13
248 0.15
249 0.15
250 0.17
251 0.17
252 0.16
253 0.21
254 0.22
255 0.23
256 0.21
257 0.19
258 0.16
259 0.16
260 0.16
261 0.11
262 0.08
263 0.08
264 0.1
265 0.1
266 0.11
267 0.11
268 0.12
269 0.13
270 0.13
271 0.12
272 0.12
273 0.12
274 0.11
275 0.1
276 0.1
277 0.1
278 0.12
279 0.12
280 0.13
281 0.13
282 0.14
283 0.15
284 0.14
285 0.14
286 0.15
287 0.18
288 0.21
289 0.25
290 0.3
291 0.38
292 0.39
293 0.45
294 0.49
295 0.5
296 0.48
297 0.5
298 0.49
299 0.42
300 0.44
301 0.4
302 0.39
303 0.35
304 0.33
305 0.27
306 0.23
307 0.21
308 0.17
309 0.16
310 0.11
311 0.11
312 0.17
313 0.18
314 0.19
315 0.21
316 0.2
317 0.19
318 0.19
319 0.17
320 0.1
321 0.11
322 0.1
323 0.09
324 0.11
325 0.12
326 0.13
327 0.13
328 0.17
329 0.17
330 0.24
331 0.29
332 0.29
333 0.34
334 0.33
335 0.36
336 0.35
337 0.38
338 0.36
339 0.37
340 0.42
341 0.38
342 0.41
343 0.41
344 0.41
345 0.39
346 0.36
347 0.3
348 0.24
349 0.22
350 0.18
351 0.15
352 0.11
353 0.08
354 0.05
355 0.06
356 0.05
357 0.05
358 0.06
359 0.08
360 0.09
361 0.1
362 0.13
363 0.17
364 0.21
365 0.21
366 0.21
367 0.21
368 0.2
369 0.22
370 0.26
371 0.21
372 0.17
373 0.17
374 0.17
375 0.15
376 0.15
377 0.16
378 0.15
379 0.18
380 0.19
381 0.21
382 0.23
383 0.24
384 0.27
385 0.26
386 0.24
387 0.24
388 0.24
389 0.26
390 0.29
391 0.31
392 0.28
393 0.28
394 0.25
395 0.25
396 0.24
397 0.24
398 0.19
399 0.19
400 0.25
401 0.22
402 0.23
403 0.21
404 0.21
405 0.19
406 0.18
407 0.16
408 0.1
409 0.11
410 0.11
411 0.09
412 0.1
413 0.1
414 0.1
415 0.12
416 0.12
417 0.11
418 0.11
419 0.1
420 0.09
421 0.08
422 0.08
423 0.06
424 0.06
425 0.06
426 0.05
427 0.06
428 0.07
429 0.06
430 0.06
431 0.07
432 0.08
433 0.08
434 0.08
435 0.1
436 0.13
437 0.19
438 0.23
439 0.25
440 0.3
441 0.35
442 0.4
443 0.49
444 0.56
445 0.58
446 0.62
447 0.71
448 0.74
449 0.78
450 0.8
451 0.77
452 0.78
453 0.8
454 0.8
455 0.75
456 0.73
457 0.73
458 0.68
459 0.63
460 0.54
461 0.49
462 0.45
463 0.41
464 0.34
465 0.29
466 0.27
467 0.27
468 0.25
469 0.2
470 0.17
471 0.18
472 0.22
473 0.21
474 0.19
475 0.2