Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067LRW7

Protein Details
Accession A0A067LRW7    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-42MKKLRRSQLPRDRPDRKLPRARPPRQRSRNPRRRSLDKAPPSBasic
51-78PGCPRRPQSHPRSRKLPRRKKSSADRASBasic
NLS Segment(s)
PositionSequence
3-74KLRRSQLPRDRPDRKLPRARPPRQRSRNPRRRSLDKAPPSGLMAREGRPGCPRRPQSHPRSRKLPRRKKSSA
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MKKLRRSQLPRDRPDRKLPRARPPRQRSRNPRRRSLDKAPPSGLMAREGRPGCPRRPQSHPRSRKLPRRKKSSADRASWHRDMQLKRYPPSTRLRAGLQGGIITGSYGRINSHAGLHDFQVRRWVLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.83
4 0.83
5 0.81
6 0.82
7 0.85
8 0.88
9 0.88
10 0.88
11 0.89
12 0.89
13 0.92
14 0.92
15 0.92
16 0.93
17 0.89
18 0.9
19 0.87
20 0.85
21 0.83
22 0.81
23 0.81
24 0.78
25 0.76
26 0.68
27 0.6
28 0.53
29 0.47
30 0.38
31 0.31
32 0.25
33 0.2
34 0.25
35 0.24
36 0.24
37 0.29
38 0.32
39 0.31
40 0.39
41 0.44
42 0.42
43 0.51
44 0.58
45 0.62
46 0.69
47 0.74
48 0.71
49 0.75
50 0.78
51 0.8
52 0.82
53 0.82
54 0.81
55 0.81
56 0.81
57 0.8
58 0.82
59 0.83
60 0.79
61 0.74
62 0.7
63 0.68
64 0.69
65 0.63
66 0.53
67 0.46
68 0.44
69 0.41
70 0.43
71 0.44
72 0.42
73 0.41
74 0.47
75 0.46
76 0.45
77 0.51
78 0.5
79 0.46
80 0.43
81 0.44
82 0.42
83 0.42
84 0.38
85 0.3
86 0.23
87 0.19
88 0.16
89 0.13
90 0.09
91 0.07
92 0.06
93 0.06
94 0.06
95 0.07
96 0.08
97 0.11
98 0.11
99 0.14
100 0.17
101 0.19
102 0.2
103 0.22
104 0.29
105 0.28
106 0.27
107 0.33