Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MT00

Protein Details
Accession A0A067MT00    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
67-92AARAAKAEQRSKRKRQHEKSLELKFLHydrophilic
NLS Segment(s)
PositionSequence
72-81KAEQRSKRKR
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MLCVHPQPAPLALQPLLDVSEEAQIRHLRTRALDAELSAKRRERELATLIQLRSKARSSLYLFDEAAARAAKAEQRSKRKRQHEKSLELKFLLTLKSPSPPQSPEPTPSEPAEAVAEDEKVKVVDAVGPVPAPPELPLAPPPTPVHTRRHTRSTKSPPVVTHRVSPAMPPPANSIPLRSHTVITSPAQLVARMIFRRREPTRPLSGRTPPICPGTPRPYVRSCLSRPVLDLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.14
5 0.13
6 0.09
7 0.14
8 0.14
9 0.14
10 0.18
11 0.2
12 0.22
13 0.27
14 0.28
15 0.25
16 0.26
17 0.32
18 0.3
19 0.31
20 0.3
21 0.25
22 0.32
23 0.33
24 0.35
25 0.33
26 0.34
27 0.31
28 0.33
29 0.36
30 0.32
31 0.33
32 0.35
33 0.36
34 0.38
35 0.42
36 0.4
37 0.39
38 0.38
39 0.33
40 0.32
41 0.29
42 0.25
43 0.2
44 0.27
45 0.28
46 0.31
47 0.33
48 0.33
49 0.31
50 0.29
51 0.29
52 0.22
53 0.2
54 0.14
55 0.11
56 0.08
57 0.09
58 0.12
59 0.16
60 0.24
61 0.3
62 0.41
63 0.51
64 0.6
65 0.69
66 0.77
67 0.83
68 0.85
69 0.88
70 0.87
71 0.86
72 0.85
73 0.82
74 0.74
75 0.63
76 0.53
77 0.43
78 0.34
79 0.26
80 0.18
81 0.13
82 0.11
83 0.14
84 0.15
85 0.18
86 0.19
87 0.21
88 0.24
89 0.29
90 0.3
91 0.31
92 0.35
93 0.34
94 0.33
95 0.31
96 0.3
97 0.23
98 0.21
99 0.18
100 0.12
101 0.1
102 0.08
103 0.08
104 0.06
105 0.07
106 0.06
107 0.05
108 0.05
109 0.05
110 0.04
111 0.06
112 0.06
113 0.06
114 0.07
115 0.06
116 0.06
117 0.07
118 0.07
119 0.05
120 0.05
121 0.07
122 0.07
123 0.08
124 0.11
125 0.15
126 0.15
127 0.18
128 0.18
129 0.2
130 0.25
131 0.27
132 0.31
133 0.35
134 0.44
135 0.46
136 0.55
137 0.57
138 0.59
139 0.66
140 0.7
141 0.72
142 0.69
143 0.68
144 0.62
145 0.64
146 0.64
147 0.56
148 0.5
149 0.43
150 0.4
151 0.37
152 0.34
153 0.31
154 0.33
155 0.31
156 0.28
157 0.31
158 0.3
159 0.34
160 0.33
161 0.3
162 0.25
163 0.29
164 0.32
165 0.28
166 0.27
167 0.23
168 0.25
169 0.25
170 0.23
171 0.23
172 0.18
173 0.2
174 0.19
175 0.19
176 0.18
177 0.16
178 0.21
179 0.21
180 0.24
181 0.26
182 0.3
183 0.39
184 0.43
185 0.49
186 0.51
187 0.55
188 0.62
189 0.63
190 0.65
191 0.63
192 0.67
193 0.68
194 0.64
195 0.6
196 0.53
197 0.53
198 0.51
199 0.48
200 0.49
201 0.47
202 0.53
203 0.54
204 0.56
205 0.55
206 0.57
207 0.58
208 0.58
209 0.54
210 0.55
211 0.56
212 0.51