Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067M543

Protein Details
Accession A0A067M543    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
437-484KIEMLGKRRTERRPDRDSRDRQSADRDSNQRKGNRRREAKPWREAWKLBasic
NLS Segment(s)
PositionSequence
443-479KRRTERRPDRDSRDRQSADRDSNQRKGNRRREAKPWR
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR043837  Mtf2-like_C  
IPR040009  Mtf2/C5D6.12-like  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF19189  Mtf2  
Amino Acid Sequences MLSHVGRTQRTAHHLSAVFVRRSTQGKGKRVDTPLLQSTKAASTSSSPDASSAPNRVDPWDEVFEGISPKIPPKGAPVKYPRLPPNFFNGVVPSGRRPYSTQARDHNLMHDDLHSDFAASAPEDDFFAPLQAPKDTGWDHLFQDLDTTPPVMVSPHHHRGGIDTTSPPRIGYQQRVPMTNQETKTFDQMFTVIFDSTKKMEYPTELEDLLKPSRARRDPLADIGIGNGPGRSQDMRGLFNKLRRTSKKVKDKTETDELVDRKKQEMEECGTDQKLMEWAVREVFAEKPPVDPSFPTPQTPESEKSTTESSSVPKSLMHSQAYPYLLGELMRAFRTRFNDPHSALALFHHARNISIISYVLGCTTSAYNELLRTRWQSFRDLHGVADALEEMRVNGVIADSQTNQFVEELRRDLGRMKAEGWVDWAMPETDTWELLAKIEMLGKRRTERRPDRDSRDRQSADRDSNQRKGNRRREAKPWREAWKLGDTHRGPDRLEMTEEGYQPII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.47
4 0.48
5 0.43
6 0.37
7 0.38
8 0.35
9 0.37
10 0.41
11 0.41
12 0.43
13 0.5
14 0.56
15 0.59
16 0.62
17 0.64
18 0.64
19 0.59
20 0.57
21 0.57
22 0.54
23 0.5
24 0.42
25 0.4
26 0.37
27 0.34
28 0.26
29 0.19
30 0.19
31 0.23
32 0.27
33 0.25
34 0.22
35 0.22
36 0.23
37 0.26
38 0.27
39 0.26
40 0.25
41 0.27
42 0.28
43 0.29
44 0.32
45 0.29
46 0.31
47 0.31
48 0.28
49 0.25
50 0.24
51 0.23
52 0.22
53 0.2
54 0.17
55 0.14
56 0.16
57 0.19
58 0.19
59 0.19
60 0.26
61 0.36
62 0.36
63 0.44
64 0.5
65 0.56
66 0.61
67 0.68
68 0.68
69 0.67
70 0.67
71 0.6
72 0.6
73 0.56
74 0.51
75 0.44
76 0.38
77 0.32
78 0.3
79 0.3
80 0.26
81 0.25
82 0.26
83 0.26
84 0.27
85 0.32
86 0.41
87 0.45
88 0.48
89 0.52
90 0.58
91 0.6
92 0.58
93 0.55
94 0.46
95 0.41
96 0.34
97 0.27
98 0.22
99 0.18
100 0.19
101 0.14
102 0.12
103 0.11
104 0.1
105 0.1
106 0.09
107 0.09
108 0.07
109 0.08
110 0.08
111 0.08
112 0.09
113 0.08
114 0.08
115 0.08
116 0.09
117 0.11
118 0.1
119 0.12
120 0.11
121 0.15
122 0.16
123 0.19
124 0.2
125 0.21
126 0.21
127 0.22
128 0.22
129 0.17
130 0.19
131 0.15
132 0.14
133 0.12
134 0.11
135 0.09
136 0.08
137 0.09
138 0.07
139 0.08
140 0.13
141 0.21
142 0.27
143 0.29
144 0.3
145 0.29
146 0.32
147 0.36
148 0.32
149 0.25
150 0.21
151 0.23
152 0.25
153 0.25
154 0.22
155 0.18
156 0.22
157 0.25
158 0.29
159 0.33
160 0.39
161 0.41
162 0.43
163 0.43
164 0.44
165 0.45
166 0.44
167 0.39
168 0.34
169 0.35
170 0.34
171 0.38
172 0.33
173 0.27
174 0.21
175 0.2
176 0.17
177 0.15
178 0.15
179 0.1
180 0.09
181 0.09
182 0.1
183 0.11
184 0.12
185 0.11
186 0.11
187 0.12
188 0.14
189 0.17
190 0.18
191 0.19
192 0.18
193 0.18
194 0.18
195 0.2
196 0.18
197 0.19
198 0.16
199 0.17
200 0.26
201 0.28
202 0.3
203 0.31
204 0.37
205 0.36
206 0.39
207 0.37
208 0.29
209 0.26
210 0.24
211 0.2
212 0.14
213 0.11
214 0.07
215 0.05
216 0.05
217 0.07
218 0.07
219 0.07
220 0.11
221 0.13
222 0.16
223 0.18
224 0.23
225 0.24
226 0.29
227 0.34
228 0.35
229 0.42
230 0.43
231 0.5
232 0.54
233 0.62
234 0.68
235 0.69
236 0.73
237 0.72
238 0.72
239 0.69
240 0.67
241 0.58
242 0.49
243 0.46
244 0.39
245 0.37
246 0.35
247 0.3
248 0.23
249 0.24
250 0.23
251 0.2
252 0.23
253 0.21
254 0.23
255 0.23
256 0.24
257 0.22
258 0.21
259 0.19
260 0.15
261 0.13
262 0.1
263 0.09
264 0.09
265 0.09
266 0.1
267 0.1
268 0.1
269 0.09
270 0.1
271 0.11
272 0.13
273 0.12
274 0.13
275 0.15
276 0.16
277 0.16
278 0.15
279 0.18
280 0.24
281 0.25
282 0.25
283 0.24
284 0.25
285 0.28
286 0.31
287 0.3
288 0.26
289 0.27
290 0.26
291 0.27
292 0.27
293 0.23
294 0.21
295 0.19
296 0.16
297 0.18
298 0.18
299 0.16
300 0.15
301 0.17
302 0.21
303 0.25
304 0.24
305 0.22
306 0.23
307 0.27
308 0.27
309 0.24
310 0.19
311 0.14
312 0.12
313 0.11
314 0.1
315 0.07
316 0.08
317 0.09
318 0.1
319 0.1
320 0.14
321 0.18
322 0.23
323 0.25
324 0.3
325 0.36
326 0.37
327 0.39
328 0.38
329 0.34
330 0.29
331 0.26
332 0.27
333 0.2
334 0.19
335 0.18
336 0.16
337 0.16
338 0.17
339 0.17
340 0.11
341 0.1
342 0.1
343 0.08
344 0.08
345 0.08
346 0.07
347 0.07
348 0.06
349 0.07
350 0.07
351 0.07
352 0.08
353 0.09
354 0.1
355 0.12
356 0.14
357 0.14
358 0.17
359 0.21
360 0.24
361 0.29
362 0.3
363 0.33
364 0.35
365 0.39
366 0.42
367 0.38
368 0.34
369 0.3
370 0.28
371 0.22
372 0.19
373 0.13
374 0.07
375 0.07
376 0.06
377 0.05
378 0.05
379 0.05
380 0.05
381 0.04
382 0.04
383 0.05
384 0.06
385 0.08
386 0.09
387 0.1
388 0.12
389 0.12
390 0.12
391 0.12
392 0.14
393 0.15
394 0.17
395 0.19
396 0.19
397 0.19
398 0.2
399 0.23
400 0.26
401 0.27
402 0.25
403 0.23
404 0.27
405 0.27
406 0.27
407 0.27
408 0.23
409 0.18
410 0.17
411 0.17
412 0.13
413 0.12
414 0.12
415 0.1
416 0.1
417 0.1
418 0.1
419 0.1
420 0.1
421 0.1
422 0.11
423 0.09
424 0.09
425 0.14
426 0.16
427 0.19
428 0.24
429 0.28
430 0.35
431 0.43
432 0.51
433 0.57
434 0.66
435 0.71
436 0.77
437 0.82
438 0.84
439 0.87
440 0.88
441 0.85
442 0.85
443 0.79
444 0.72
445 0.71
446 0.7
447 0.67
448 0.66
449 0.68
450 0.65
451 0.7
452 0.74
453 0.73
454 0.74
455 0.77
456 0.79
457 0.8
458 0.82
459 0.8
460 0.84
461 0.87
462 0.87
463 0.86
464 0.83
465 0.81
466 0.78
467 0.75
468 0.69
469 0.67
470 0.62
471 0.56
472 0.58
473 0.51
474 0.51
475 0.55
476 0.53
477 0.44
478 0.46
479 0.46
480 0.39
481 0.41
482 0.36
483 0.34
484 0.36
485 0.36