Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067M9F3

Protein Details
Accession A0A067M9F3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-70IICCRCCGSRRRTRTRTTSTRRWGRRYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, mito 3, cyto 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGSIFSAIGSAINSVISAIASVIMAIVGGIITVIVTIIYFIEDIICCRCCGSRRRTRTRTTSTRRWGRRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.01
18 0.01
19 0.01
20 0.02
21 0.01
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.03
29 0.04
30 0.05
31 0.08
32 0.09
33 0.08
34 0.09
35 0.12
36 0.17
37 0.25
38 0.34
39 0.42
40 0.52
41 0.63
42 0.71
43 0.77
44 0.82
45 0.84
46 0.85
47 0.84
48 0.84
49 0.84
50 0.87