Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MY82

Protein Details
Accession A0A067MY82    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
65-84ADTPGEKPPKRKKGEIRRTQBasic
NLS Segment(s)
PositionSequence
69-82GEKPPKRKKGEIRR
Subcellular Location(s) nucl 18, mito_nucl 13.166, cyto_nucl 11.666, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS01360  ZF_MYND_1  
PS50865  ZF_MYND_2  
Amino Acid Sequences MNFNIPRPDKSKCTTCGASSQSSFRMCSKCRVTPYCSVDCQRADWPSHKKICNALLMNRAFKAPADTPGEKPPKRKKGEIRRTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.48
3 0.5
4 0.48
5 0.46
6 0.4
7 0.39
8 0.35
9 0.34
10 0.33
11 0.3
12 0.32
13 0.29
14 0.36
15 0.39
16 0.4
17 0.45
18 0.48
19 0.48
20 0.51
21 0.55
22 0.51
23 0.48
24 0.45
25 0.41
26 0.37
27 0.35
28 0.29
29 0.25
30 0.23
31 0.26
32 0.31
33 0.35
34 0.41
35 0.41
36 0.4
37 0.42
38 0.43
39 0.45
40 0.41
41 0.37
42 0.38
43 0.39
44 0.39
45 0.35
46 0.31
47 0.24
48 0.22
49 0.23
50 0.17
51 0.2
52 0.25
53 0.28
54 0.31
55 0.4
56 0.5
57 0.48
58 0.56
59 0.61
60 0.64
61 0.69
62 0.76
63 0.77
64 0.79