Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067N7D2

Protein Details
Accession A0A067N7D2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
78-106IVPPLPRKLSPPRRFPRRRRVQEILLPRTHydrophilic
NLS Segment(s)
PositionSequence
83-115PRKLSPPRRFPRRRRVQEILLPRTLPRKRRPLK
Subcellular Location(s) mito 16, extr 4, cyto_nucl 4, nucl 3.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MQKRCHHQCRSLLIPFVRALTTNALAVRCVIAGHRQPPGLSGERAPLFHIASDITVTIVAHWLPTPRRTSCLSFDTAIVPPLPRKLSPPRRFPRRRRVQEILLPRTLPRKRRPLKVSPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.46
3 0.4
4 0.32
5 0.25
6 0.22
7 0.19
8 0.18
9 0.17
10 0.18
11 0.16
12 0.16
13 0.15
14 0.14
15 0.1
16 0.09
17 0.08
18 0.12
19 0.16
20 0.19
21 0.21
22 0.21
23 0.21
24 0.23
25 0.26
26 0.24
27 0.21
28 0.19
29 0.21
30 0.22
31 0.22
32 0.22
33 0.18
34 0.15
35 0.14
36 0.14
37 0.09
38 0.08
39 0.08
40 0.06
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.07
50 0.08
51 0.12
52 0.16
53 0.16
54 0.2
55 0.23
56 0.26
57 0.28
58 0.3
59 0.29
60 0.26
61 0.25
62 0.25
63 0.22
64 0.19
65 0.16
66 0.13
67 0.12
68 0.15
69 0.17
70 0.15
71 0.2
72 0.3
73 0.41
74 0.48
75 0.58
76 0.64
77 0.74
78 0.84
79 0.88
80 0.89
81 0.89
82 0.91
83 0.89
84 0.87
85 0.84
86 0.83
87 0.83
88 0.78
89 0.71
90 0.61
91 0.54
92 0.56
93 0.54
94 0.54
95 0.53
96 0.58
97 0.62
98 0.72
99 0.78