Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MQV6

Protein Details
Accession A0A067MQV6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-32PSPFSPFRVNRPRLRLPRRPPIPPRHydrophilic
NLS Segment(s)
PositionSequence
18-33RPRLRLPRRPPIPPRH
Subcellular Location(s) mito 21, extr 4
Family & Domain DBs
Amino Acid Sequences MLTLARIPSPFSPFRVNRPRLRLPRRPPIPPRHLPLRRNACCNHPRVAPLPVLGLCFTRAALRLCDPHPATRRLYHRTGGGQRCIAEGSTYPVQHKIHERL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.54
3 0.58
4 0.59
5 0.65
6 0.72
7 0.73
8 0.8
9 0.8
10 0.78
11 0.82
12 0.8
13 0.81
14 0.8
15 0.8
16 0.79
17 0.76
18 0.73
19 0.73
20 0.75
21 0.69
22 0.69
23 0.7
24 0.64
25 0.63
26 0.59
27 0.57
28 0.54
29 0.55
30 0.48
31 0.38
32 0.37
33 0.34
34 0.35
35 0.26
36 0.21
37 0.19
38 0.15
39 0.15
40 0.13
41 0.1
42 0.09
43 0.08
44 0.08
45 0.07
46 0.09
47 0.1
48 0.11
49 0.13
50 0.16
51 0.17
52 0.24
53 0.24
54 0.3
55 0.33
56 0.35
57 0.37
58 0.41
59 0.47
60 0.46
61 0.48
62 0.43
63 0.42
64 0.47
65 0.53
66 0.52
67 0.5
68 0.47
69 0.43
70 0.42
71 0.38
72 0.3
73 0.23
74 0.17
75 0.19
76 0.21
77 0.22
78 0.23
79 0.28
80 0.29
81 0.33