Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QUF1

Protein Details
Accession B6QUF1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
196-225LGQNKRSNKGQAKIRQRERREKGNRYTLQLHydrophilic
NLS Segment(s)
PositionSequence
203-217NKGQAKIRQRERREK
Subcellular Location(s) nucl 13, cyto_nucl 11, cyto 7, mito 6
Family & Domain DBs
KEGG tmf:PMAA_008940  -  
Amino Acid Sequences MASLPACARPVGVRISLFSYGHANGPIVQQQQHNEARYHKTLAYNIRHLPNPPRQLRVNATGMSRRLQKEFLQNDNVEAFLEKVRGEICNAVNEECGQFLNFIEEQDQSKRGGSEETDQHSVLNAHNSSELIADIDIVVTICCEEGRHRSVAFVEELARRLAVLGDGEDGLSPYWQPTINVIHRDIGGEEECEQALGQNKRSNKGQAKIRQRERREKGNRYTLQLGDDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.27
4 0.26
5 0.24
6 0.24
7 0.21
8 0.22
9 0.21
10 0.18
11 0.16
12 0.18
13 0.22
14 0.21
15 0.22
16 0.24
17 0.26
18 0.33
19 0.38
20 0.38
21 0.36
22 0.39
23 0.42
24 0.43
25 0.43
26 0.38
27 0.36
28 0.39
29 0.45
30 0.46
31 0.46
32 0.48
33 0.48
34 0.48
35 0.47
36 0.5
37 0.5
38 0.53
39 0.51
40 0.5
41 0.49
42 0.53
43 0.55
44 0.53
45 0.48
46 0.4
47 0.39
48 0.39
49 0.37
50 0.35
51 0.36
52 0.32
53 0.3
54 0.31
55 0.31
56 0.37
57 0.41
58 0.42
59 0.42
60 0.4
61 0.39
62 0.36
63 0.33
64 0.23
65 0.18
66 0.13
67 0.08
68 0.09
69 0.07
70 0.07
71 0.08
72 0.08
73 0.09
74 0.11
75 0.11
76 0.14
77 0.15
78 0.15
79 0.15
80 0.15
81 0.14
82 0.11
83 0.1
84 0.07
85 0.06
86 0.06
87 0.08
88 0.08
89 0.08
90 0.09
91 0.09
92 0.11
93 0.12
94 0.13
95 0.11
96 0.11
97 0.12
98 0.11
99 0.11
100 0.11
101 0.13
102 0.16
103 0.19
104 0.2
105 0.2
106 0.19
107 0.19
108 0.18
109 0.15
110 0.15
111 0.12
112 0.1
113 0.11
114 0.11
115 0.1
116 0.1
117 0.09
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.05
132 0.1
133 0.14
134 0.16
135 0.16
136 0.17
137 0.18
138 0.19
139 0.18
140 0.14
141 0.14
142 0.14
143 0.15
144 0.15
145 0.13
146 0.11
147 0.11
148 0.1
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.06
158 0.06
159 0.05
160 0.05
161 0.07
162 0.07
163 0.08
164 0.1
165 0.18
166 0.23
167 0.27
168 0.28
169 0.28
170 0.28
171 0.28
172 0.25
173 0.21
174 0.16
175 0.14
176 0.14
177 0.13
178 0.13
179 0.12
180 0.12
181 0.11
182 0.18
183 0.21
184 0.25
185 0.29
186 0.33
187 0.37
188 0.42
189 0.5
190 0.5
191 0.55
192 0.59
193 0.64
194 0.72
195 0.78
196 0.84
197 0.85
198 0.86
199 0.89
200 0.87
201 0.88
202 0.88
203 0.87
204 0.86
205 0.87
206 0.82
207 0.78
208 0.77
209 0.67