Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QS56

Protein Details
Accession B6QS56    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-55MVKLGKKSKRTPVRLRHKIEKAGAAKQRKARKQAKKDPTWRSKIKKDPGIPNLFPHydrophilic
380-401FPNSHKASSKKKRENDEARLVLHydrophilic
NLS Segment(s)
PositionSequence
5-48GKKSKRTPVRLRHKIEKAGAAKQRKARKQAKKDPTWRSKIKKDP
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR030378  G_CP_dom  
IPR014813  Gnl3_N_dom  
IPR006073  GTP-bd  
IPR023179  GTP-bd_ortho_bundle_sf  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
KEGG tmf:PMAA_043820  -  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
PF01926  MMR_HSR1  
PROSITE View protein in PROSITE  
PS51721  G_CP  
CDD cd04178  Nucleostemin_like  
Amino Acid Sequences MVKLGKKSKRTPVRLRHKIEKAGAAKQRKARKQAKKDPTWRSKIKKDPGIPNLFPFKDKILAEIEEKKRQKQEEQLRIREEARERCKAEKKAAGIETADDEDDEINDDIDIEDDDEDEDIDGMDEDGDDSNPMAALLASARARAAEYEENEDEMSEDYDDDDEDRMDQDGEEGGISLSQGDIPTIASQVASKESSRRAFDKVFKQVAQAADVILYVLDARDPEGTRSKDVEREIMAAEGGSKRLILILNKIDLVPPAVLKGWLIHLRRYFPTLPLKASNGAPNAHSFDHKQLTVKGTSETLFKALKSYSQTSQLKRAISVGVIGYPNVGKSSVINALTARLNRGRSNACPTGAEAGVTTSLREVKLDSKLKLIDSPGIVFPNSHKASSKKKRENDEARLVLLNAVPPKQITDPIPAVNLLLKRLSATNETLFQKMLGLYGINSLFPMNGGDTTTDFLIQVARNRGRLGKGGVPNIASAAMAVITDWRDGRIQGWLEPPVLAVAGVNTPASSDAATAGDNGPAADVKEIVTEWAKEFNIEGLWGNGESDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.9
4 0.88
5 0.86
6 0.81
7 0.79
8 0.73
9 0.72
10 0.72
11 0.7
12 0.69
13 0.68
14 0.73
15 0.72
16 0.78
17 0.79
18 0.81
19 0.84
20 0.88
21 0.9
22 0.91
23 0.93
24 0.93
25 0.93
26 0.92
27 0.91
28 0.89
29 0.89
30 0.88
31 0.88
32 0.87
33 0.85
34 0.85
35 0.85
36 0.85
37 0.77
38 0.73
39 0.71
40 0.63
41 0.55
42 0.47
43 0.4
44 0.37
45 0.35
46 0.31
47 0.26
48 0.28
49 0.31
50 0.39
51 0.43
52 0.46
53 0.5
54 0.53
55 0.56
56 0.58
57 0.6
58 0.61
59 0.65
60 0.66
61 0.73
62 0.75
63 0.71
64 0.7
65 0.65
66 0.61
67 0.58
68 0.57
69 0.54
70 0.55
71 0.54
72 0.59
73 0.67
74 0.66
75 0.67
76 0.63
77 0.59
78 0.59
79 0.58
80 0.52
81 0.43
82 0.38
83 0.32
84 0.27
85 0.23
86 0.14
87 0.13
88 0.11
89 0.1
90 0.11
91 0.09
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.05
99 0.05
100 0.05
101 0.06
102 0.06
103 0.06
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.08
125 0.08
126 0.08
127 0.08
128 0.08
129 0.09
130 0.09
131 0.13
132 0.14
133 0.16
134 0.22
135 0.22
136 0.23
137 0.23
138 0.22
139 0.18
140 0.14
141 0.13
142 0.07
143 0.07
144 0.06
145 0.07
146 0.07
147 0.07
148 0.07
149 0.06
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.06
157 0.06
158 0.06
159 0.05
160 0.05
161 0.04
162 0.04
163 0.04
164 0.03
165 0.04
166 0.04
167 0.04
168 0.04
169 0.05
170 0.05
171 0.06
172 0.06
173 0.05
174 0.06
175 0.07
176 0.09
177 0.1
178 0.1
179 0.13
180 0.19
181 0.23
182 0.26
183 0.27
184 0.3
185 0.34
186 0.4
187 0.45
188 0.48
189 0.47
190 0.45
191 0.44
192 0.43
193 0.38
194 0.33
195 0.25
196 0.16
197 0.12
198 0.11
199 0.1
200 0.06
201 0.05
202 0.03
203 0.03
204 0.03
205 0.03
206 0.04
207 0.06
208 0.07
209 0.1
210 0.17
211 0.19
212 0.2
213 0.23
214 0.24
215 0.26
216 0.27
217 0.27
218 0.21
219 0.21
220 0.19
221 0.16
222 0.15
223 0.1
224 0.1
225 0.08
226 0.07
227 0.06
228 0.05
229 0.05
230 0.06
231 0.08
232 0.07
233 0.11
234 0.13
235 0.13
236 0.14
237 0.14
238 0.13
239 0.12
240 0.12
241 0.08
242 0.07
243 0.06
244 0.06
245 0.06
246 0.06
247 0.06
248 0.08
249 0.14
250 0.15
251 0.19
252 0.2
253 0.23
254 0.24
255 0.28
256 0.25
257 0.24
258 0.31
259 0.29
260 0.29
261 0.28
262 0.29
263 0.26
264 0.27
265 0.26
266 0.2
267 0.18
268 0.17
269 0.16
270 0.17
271 0.16
272 0.16
273 0.14
274 0.16
275 0.18
276 0.18
277 0.18
278 0.18
279 0.2
280 0.2
281 0.2
282 0.16
283 0.15
284 0.15
285 0.15
286 0.13
287 0.13
288 0.12
289 0.11
290 0.12
291 0.11
292 0.14
293 0.17
294 0.19
295 0.18
296 0.27
297 0.33
298 0.33
299 0.41
300 0.42
301 0.38
302 0.35
303 0.35
304 0.26
305 0.21
306 0.2
307 0.12
308 0.1
309 0.1
310 0.09
311 0.08
312 0.08
313 0.08
314 0.07
315 0.07
316 0.05
317 0.05
318 0.08
319 0.12
320 0.12
321 0.12
322 0.12
323 0.14
324 0.16
325 0.16
326 0.17
327 0.16
328 0.18
329 0.19
330 0.23
331 0.24
332 0.25
333 0.33
334 0.32
335 0.3
336 0.28
337 0.27
338 0.27
339 0.23
340 0.2
341 0.12
342 0.1
343 0.11
344 0.1
345 0.09
346 0.07
347 0.09
348 0.09
349 0.09
350 0.1
351 0.12
352 0.21
353 0.26
354 0.26
355 0.28
356 0.29
357 0.3
358 0.31
359 0.28
360 0.23
361 0.19
362 0.2
363 0.18
364 0.18
365 0.17
366 0.15
367 0.15
368 0.22
369 0.22
370 0.21
371 0.23
372 0.27
373 0.38
374 0.48
375 0.58
376 0.58
377 0.64
378 0.72
379 0.79
380 0.84
381 0.82
382 0.81
383 0.72
384 0.64
385 0.57
386 0.49
387 0.39
388 0.3
389 0.24
390 0.16
391 0.15
392 0.13
393 0.12
394 0.14
395 0.15
396 0.18
397 0.17
398 0.21
399 0.23
400 0.24
401 0.25
402 0.22
403 0.22
404 0.22
405 0.2
406 0.16
407 0.14
408 0.12
409 0.13
410 0.14
411 0.16
412 0.16
413 0.18
414 0.19
415 0.25
416 0.27
417 0.27
418 0.25
419 0.23
420 0.21
421 0.18
422 0.16
423 0.1
424 0.08
425 0.08
426 0.11
427 0.11
428 0.1
429 0.1
430 0.1
431 0.09
432 0.09
433 0.09
434 0.07
435 0.07
436 0.08
437 0.09
438 0.09
439 0.11
440 0.11
441 0.1
442 0.09
443 0.09
444 0.12
445 0.13
446 0.18
447 0.25
448 0.28
449 0.29
450 0.32
451 0.35
452 0.34
453 0.37
454 0.37
455 0.36
456 0.39
457 0.41
458 0.41
459 0.38
460 0.36
461 0.32
462 0.27
463 0.18
464 0.12
465 0.08
466 0.06
467 0.05
468 0.05
469 0.06
470 0.07
471 0.08
472 0.09
473 0.1
474 0.11
475 0.12
476 0.13
477 0.18
478 0.19
479 0.21
480 0.25
481 0.26
482 0.26
483 0.25
484 0.25
485 0.18
486 0.16
487 0.13
488 0.08
489 0.07
490 0.07
491 0.08
492 0.08
493 0.07
494 0.07
495 0.08
496 0.09
497 0.08
498 0.07
499 0.08
500 0.09
501 0.09
502 0.11
503 0.1
504 0.11
505 0.1
506 0.1
507 0.1
508 0.09
509 0.1
510 0.09
511 0.09
512 0.08
513 0.1
514 0.1
515 0.12
516 0.14
517 0.15
518 0.16
519 0.21
520 0.21
521 0.2
522 0.2
523 0.2
524 0.18
525 0.17
526 0.17
527 0.12
528 0.14
529 0.14