Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MG92

Protein Details
Accession A0A067MG92   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
244-269IETPAEYKEKQRRIRREKQRGKKTPLBasic
NLS Segment(s)
PositionSequence
252-268EKQRRIRREKQRGKKTP
Subcellular Location(s) cyto 12, mito 9, cyto_nucl 8, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035437  SNase_OB-fold_sf  
IPR016071  Staphylococal_nuclease_OB-fold  
Pfam View protein in Pfam  
PF00565  SNase  
PROSITE View protein in PROSITE  
PS50830  TNASE_3  
Amino Acid Sequences MLILNIPPTPSIGNGGGWQWPWSTKKAPEPAPLRVPPSIYSYGIGTAALIAGIGFLAKKGHANLRRLPNVKAITAACIRAQRTIRGVVTNVRDPDNFRLFHTPRPWWSWTRRVPVKARDLRGQTLHIRIAGADAPELGYFGKPRQIYAKAAQEWLASQIQGKVVFCTFHRVDHYGRVVSTVYYRPTPESPYVNLSLEMVRKGLACVYTQYGAVYGAEGKDQYMEAQQEAQREQRGMWAQGLEGIETPAEYKEKQRRIRREKQRGKKTPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.19
4 0.18
5 0.19
6 0.16
7 0.2
8 0.22
9 0.26
10 0.31
11 0.34
12 0.42
13 0.5
14 0.55
15 0.59
16 0.61
17 0.64
18 0.66
19 0.64
20 0.59
21 0.52
22 0.48
23 0.4
24 0.41
25 0.37
26 0.29
27 0.26
28 0.23
29 0.22
30 0.2
31 0.18
32 0.11
33 0.08
34 0.07
35 0.05
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.02
42 0.03
43 0.04
44 0.04
45 0.07
46 0.09
47 0.19
48 0.25
49 0.3
50 0.38
51 0.47
52 0.55
53 0.56
54 0.55
55 0.55
56 0.51
57 0.46
58 0.41
59 0.32
60 0.28
61 0.27
62 0.27
63 0.21
64 0.22
65 0.23
66 0.25
67 0.26
68 0.25
69 0.26
70 0.29
71 0.28
72 0.26
73 0.26
74 0.26
75 0.28
76 0.3
77 0.29
78 0.27
79 0.26
80 0.27
81 0.32
82 0.32
83 0.28
84 0.26
85 0.33
86 0.33
87 0.38
88 0.41
89 0.38
90 0.36
91 0.41
92 0.43
93 0.39
94 0.44
95 0.47
96 0.49
97 0.55
98 0.57
99 0.58
100 0.61
101 0.62
102 0.67
103 0.64
104 0.61
105 0.57
106 0.55
107 0.51
108 0.46
109 0.43
110 0.35
111 0.31
112 0.28
113 0.22
114 0.18
115 0.15
116 0.15
117 0.12
118 0.09
119 0.06
120 0.05
121 0.06
122 0.05
123 0.06
124 0.05
125 0.04
126 0.05
127 0.05
128 0.1
129 0.1
130 0.11
131 0.15
132 0.18
133 0.21
134 0.25
135 0.32
136 0.29
137 0.29
138 0.3
139 0.25
140 0.23
141 0.22
142 0.18
143 0.1
144 0.1
145 0.1
146 0.11
147 0.12
148 0.12
149 0.1
150 0.1
151 0.11
152 0.11
153 0.17
154 0.16
155 0.17
156 0.2
157 0.22
158 0.23
159 0.28
160 0.3
161 0.24
162 0.23
163 0.22
164 0.2
165 0.18
166 0.19
167 0.16
168 0.15
169 0.16
170 0.17
171 0.19
172 0.2
173 0.24
174 0.25
175 0.25
176 0.25
177 0.28
178 0.3
179 0.27
180 0.26
181 0.22
182 0.21
183 0.19
184 0.18
185 0.13
186 0.11
187 0.11
188 0.11
189 0.12
190 0.1
191 0.1
192 0.11
193 0.14
194 0.14
195 0.14
196 0.14
197 0.12
198 0.12
199 0.11
200 0.09
201 0.08
202 0.07
203 0.08
204 0.08
205 0.07
206 0.08
207 0.08
208 0.08
209 0.11
210 0.12
211 0.12
212 0.17
213 0.19
214 0.22
215 0.24
216 0.27
217 0.27
218 0.26
219 0.26
220 0.28
221 0.3
222 0.29
223 0.29
224 0.25
225 0.22
226 0.25
227 0.26
228 0.19
229 0.15
230 0.13
231 0.11
232 0.1
233 0.11
234 0.09
235 0.12
236 0.12
237 0.21
238 0.31
239 0.41
240 0.51
241 0.6
242 0.7
243 0.77
244 0.87
245 0.89
246 0.91
247 0.92
248 0.94
249 0.95