Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067M2F1

Protein Details
Accession A0A067M2F1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
96-117VEEETSTEPKRRKKRAKVDDDDAcidic
NLS Segment(s)
PositionSequence
105-112KRRKKRAK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MRNKNKVTKFPVARIKKIMQKDEEVGKVAQATPILISKALELFMGSLVEEMTKVAVQRSIRRVEIWHLKHAIEQIDTFDFLREIVQPIPDPTNGGVEEETSTEPKRRKKRAKVDDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.69
3 0.66
4 0.67
5 0.66
6 0.59
7 0.56
8 0.55
9 0.54
10 0.5
11 0.44
12 0.36
13 0.29
14 0.26
15 0.22
16 0.18
17 0.12
18 0.1
19 0.09
20 0.1
21 0.1
22 0.09
23 0.09
24 0.08
25 0.09
26 0.08
27 0.07
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.03
38 0.04
39 0.04
40 0.04
41 0.04
42 0.08
43 0.09
44 0.14
45 0.19
46 0.21
47 0.21
48 0.22
49 0.23
50 0.26
51 0.34
52 0.32
53 0.32
54 0.31
55 0.3
56 0.31
57 0.32
58 0.28
59 0.19
60 0.16
61 0.14
62 0.13
63 0.14
64 0.13
65 0.11
66 0.09
67 0.08
68 0.09
69 0.08
70 0.09
71 0.09
72 0.11
73 0.11
74 0.13
75 0.16
76 0.15
77 0.16
78 0.14
79 0.17
80 0.16
81 0.16
82 0.14
83 0.13
84 0.14
85 0.14
86 0.15
87 0.14
88 0.16
89 0.21
90 0.28
91 0.37
92 0.47
93 0.56
94 0.65
95 0.74
96 0.83
97 0.88