FuNGI

A0A067LR96

Protein Details

Accession

A0A067LR96

Localization Confidence

High

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
309-341	YECKWPKKGACNECHKRKRKCDGLPPGQRRSRK	Basic
348-374	EGEGEAKPRPRPKKRKPPVDKPGSPAA	Basic

NLS Segment(s)

Position	Sequence
117-132	QREKAEAKRAEKERRA
207-217	KRPVPRPPARQ
324-386	KRKRKCDGLPPGQRRSRKRDTTAGEGEGEAKPRPRPKKRKPPVDKPGSPAAPKKTAPPAKRPS

Subcellular Location(s)

nucl 10, cyto_nucl 9, mito 6, cyto 6, pero 2

Family & Domain DBs

InterPro	View protein in InterPro IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0016020 C:membrane GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0008270 F:zinc ion binding
CDD	cd00067 GAL4

Amino Acid Sequences

MDVESLLQAMANMAAAESEATRCIRGLNVMHALPARTAPSTEWHAWLKDATDYLDTLPAKLHTFEARRQSTLYVKYALAIAEARKKQEEVAQRGSEVARQEQAVAQQEARRLEQEKQREKAEAKRAEKERRAAEREIGTVARHMSQSMTLGNPEEEGGARAPMPGRSADETPRPTSGRARAVSVATPLASGSARAPPLPSFSTVQRKRPVPRPPARQAQAPPAKDAARAPPVARSPPPEAGESLPGSPMHDQQPPLPAAQLGRPREASPAALATPPASAPQGAPSPADPQDEDPPATRPPCPQCVKSGYECKWPKKGACNECHKRKRKCDGLPPGQRRSRKRDTTAGEGEGEAKPRPRPKKRKPPVDKPGSPAAPKKTAPPAKRPSSPPVSVHSSSPSPPPSRATSPSEPDEDAPRKRARLDPPEEAPASPEEIKDSQDQQDLEDPEDRRARSSDPGARFRKPYAYPNFLFMDCWLVLVWCGVVWCYR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.05
2	0.05
3	0.06
4	0.06
5	0.07
6	0.09
7	0.1
8	0.11
9	0.11
10	0.12
11	0.13
12	0.18
13	0.2
14	0.23
15	0.28
16	0.27
17	0.3
18	0.3
19	0.3
20	0.25
21	0.24
22	0.2
23	0.16
24	0.17
25	0.16
26	0.19
27	0.25
28	0.27
29	0.29
30	0.31
31	0.31
32	0.31
33	0.31
34	0.27
35	0.23
36	0.22
37	0.19
38	0.17
39	0.17
40	0.16
41	0.22
42	0.2
43	0.18
44	0.19
45	0.19
46	0.19
47	0.19
48	0.21
49	0.22
50	0.26
51	0.32
52	0.41
53	0.42
54	0.42
55	0.43
56	0.44
57	0.43
58	0.45
59	0.42
60	0.35
61	0.31
62	0.3
63	0.3
64	0.26
65	0.2
66	0.17
67	0.17
68	0.23
69	0.25
70	0.27
71	0.28
72	0.28
73	0.29
74	0.33
75	0.39
76	0.38
77	0.44
78	0.43
79	0.41
80	0.43
81	0.42
82	0.38
83	0.3
84	0.25
85	0.19
86	0.18
87	0.18
88	0.18
89	0.22
90	0.24
91	0.23
92	0.23
93	0.23
94	0.27
95	0.28
96	0.28
97	0.27
98	0.25
99	0.3
100	0.35
101	0.43
102	0.48
103	0.5
104	0.51
105	0.54
106	0.54
107	0.56
108	0.59
109	0.58
110	0.55
111	0.6
112	0.66
113	0.7
114	0.72
115	0.7
116	0.69
117	0.68
118	0.69
119	0.62
120	0.59
121	0.52
122	0.47
123	0.42
124	0.34
125	0.25
126	0.22
127	0.2
128	0.16
129	0.14
130	0.13
131	0.11
132	0.11
133	0.12
134	0.12
135	0.11
136	0.1
137	0.11
138	0.11
139	0.1
140	0.1
141	0.09
142	0.07
143	0.08
144	0.08
145	0.07
146	0.07
147	0.08
148	0.09
149	0.09
150	0.1
151	0.1
152	0.12
153	0.14
154	0.17
155	0.19
156	0.25
157	0.28
158	0.29
159	0.31
160	0.3
161	0.29
162	0.32
163	0.35
164	0.36
165	0.33
166	0.34
167	0.32
168	0.32
169	0.31
170	0.27
171	0.21
172	0.13
173	0.12
174	0.09
175	0.09
176	0.07
177	0.07
178	0.07
179	0.09
180	0.1
181	0.1
182	0.11
183	0.11
184	0.14
185	0.15
186	0.16
187	0.15
188	0.2
189	0.31
190	0.34
191	0.4
192	0.43
193	0.48
194	0.51
195	0.58
196	0.62
197	0.62
198	0.67
199	0.7
200	0.7
201	0.74
202	0.71
203	0.68
204	0.61
205	0.6
206	0.58
207	0.5
208	0.44
209	0.37
210	0.35
211	0.31
212	0.3
213	0.24
214	0.2
215	0.21
216	0.19
217	0.2
218	0.22
219	0.24
220	0.24
221	0.23
222	0.23
223	0.27
224	0.28
225	0.24
226	0.24
227	0.22
228	0.23
229	0.2
230	0.16
231	0.13
232	0.11
233	0.11
234	0.11
235	0.13
236	0.13
237	0.14
238	0.15
239	0.15
240	0.2
241	0.2
242	0.19
243	0.17
244	0.14
245	0.13
246	0.17
247	0.23
248	0.2
249	0.21
250	0.22
251	0.22
252	0.24
253	0.23
254	0.19
255	0.13
256	0.12
257	0.11
258	0.1
259	0.1
260	0.08
261	0.08
262	0.07
263	0.07
264	0.06
265	0.06
266	0.06
267	0.08
268	0.1
269	0.1
270	0.1
271	0.1
272	0.14
273	0.15
274	0.16
275	0.14
276	0.15
277	0.19
278	0.2
279	0.2
280	0.18
281	0.19
282	0.21
283	0.22
284	0.2
285	0.22
286	0.25
287	0.33
288	0.37
289	0.36
290	0.38
291	0.42
292	0.45
293	0.45
294	0.5
295	0.43
296	0.49
297	0.55
298	0.54
299	0.56
300	0.56
301	0.54
302	0.54
303	0.62
304	0.61
305	0.62
306	0.68
307	0.71
308	0.78
309	0.85
310	0.85
311	0.85
312	0.85
313	0.87
314	0.86
315	0.84
316	0.84
317	0.85
318	0.86
319	0.87
320	0.85
321	0.84
322	0.81
323	0.8
324	0.76
325	0.74
326	0.74
327	0.72
328	0.7
329	0.7
330	0.68
331	0.69
332	0.67
333	0.59
334	0.49
335	0.41
336	0.38
337	0.3
338	0.26
339	0.19
340	0.17
341	0.21
342	0.29
343	0.39
344	0.48
345	0.58
346	0.68
347	0.78
348	0.86
349	0.92
350	0.93
351	0.94
352	0.94
353	0.93
354	0.87
355	0.81
356	0.8
357	0.73
358	0.67
359	0.62
360	0.57
361	0.53
362	0.49
363	0.48
364	0.49
365	0.53
366	0.54
367	0.58
368	0.62
369	0.63
370	0.69
371	0.7
372	0.68
373	0.67
374	0.67
375	0.59
376	0.55
377	0.56
378	0.5
379	0.46
380	0.42
381	0.36
382	0.33
383	0.36
384	0.37
385	0.32
386	0.33
387	0.35
388	0.37
389	0.4
390	0.44
391	0.47
392	0.47
393	0.5
394	0.51
395	0.5
396	0.46
397	0.42
398	0.45
399	0.45
400	0.42
401	0.43
402	0.44
403	0.43
404	0.46
405	0.51
406	0.52
407	0.55
408	0.59
409	0.59
410	0.59
411	0.63
412	0.61
413	0.53
414	0.45
415	0.36
416	0.34
417	0.27
418	0.23
419	0.21
420	0.2
421	0.23
422	0.25
423	0.28
424	0.27
425	0.31
426	0.31
427	0.29
428	0.35
429	0.34
430	0.32
431	0.35
432	0.32
433	0.34
434	0.4
435	0.38
436	0.33
437	0.34
438	0.35
439	0.36
440	0.43
441	0.45
442	0.48
443	0.57
444	0.6
445	0.63
446	0.64
447	0.61
448	0.61
449	0.57
450	0.58
451	0.58
452	0.61
453	0.56
454	0.57
455	0.57
456	0.49
457	0.45
458	0.35
459	0.31
460	0.22
461	0.22
462	0.17
463	0.13
464	0.13
465	0.13
466	0.12
467	0.07
468	0.07

A0A067LR96

3D AlphaFold-predicted Structure Viewer