Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067LR96

Protein Details
Accession A0A067LR96   
Localization Confidence High
Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
309-341YECKWPKKGACNECHKRKRKCDGLPPGQRRSRKBasic
348-374EGEGEAKPRPRPKKRKPPVDKPGSPAABasic
NLS Segment(s)
PositionSequence
117-132QREKAEAKRAEKERRA
207-217KRPVPRPPARQ
324-386KRKRKCDGLPPGQRRSRKRDTTAGEGEGEAKPRPRPKKRKPPVDKPGSPAAPKKTAPPAKRPS
Subcellular Location(s) nucl 10, cyto_nucl 9, mito 6, cyto 6, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0016020  C:membrane  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
CDD cd00067  GAL4  
Amino Acid Sequences MDVESLLQAMANMAAAESEATRCIRGLNVMHALPARTAPSTEWHAWLKDATDYLDTLPAKLHTFEARRQSTLYVKYALAIAEARKKQEEVAQRGSEVARQEQAVAQQEARRLEQEKQREKAEAKRAEKERRAAEREIGTVARHMSQSMTLGNPEEEGGARAPMPGRSADETPRPTSGRARAVSVATPLASGSARAPPLPSFSTVQRKRPVPRPPARQAQAPPAKDAARAPPVARSPPPEAGESLPGSPMHDQQPPLPAAQLGRPREASPAALATPPASAPQGAPSPADPQDEDPPATRPPCPQCVKSGYECKWPKKGACNECHKRKRKCDGLPPGQRRSRKRDTTAGEGEGEAKPRPRPKKRKPPVDKPGSPAAPKKTAPPAKRPSSPPVSVHSSSPSPPPSRATSPSEPDEDAPRKRARLDPPEEAPASPEEIKDSQDQQDLEDPEDRRARSSDPGARFRKPYAYPNFLFMDCWLVLVWCGVVWCYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.07
6 0.09
7 0.1
8 0.11
9 0.11
10 0.12
11 0.13
12 0.18
13 0.2
14 0.23
15 0.28
16 0.27
17 0.3
18 0.3
19 0.3
20 0.25
21 0.24
22 0.2
23 0.16
24 0.17
25 0.16
26 0.19
27 0.25
28 0.27
29 0.29
30 0.31
31 0.31
32 0.31
33 0.31
34 0.27
35 0.23
36 0.22
37 0.19
38 0.17
39 0.17
40 0.16
41 0.22
42 0.2
43 0.18
44 0.19
45 0.19
46 0.19
47 0.19
48 0.21
49 0.22
50 0.26
51 0.32
52 0.41
53 0.42
54 0.42
55 0.43
56 0.44
57 0.43
58 0.45
59 0.42
60 0.35
61 0.31
62 0.3
63 0.3
64 0.26
65 0.2
66 0.17
67 0.17
68 0.23
69 0.25
70 0.27
71 0.28
72 0.28
73 0.29
74 0.33
75 0.39
76 0.38
77 0.44
78 0.43
79 0.41
80 0.43
81 0.42
82 0.38
83 0.3
84 0.25
85 0.19
86 0.18
87 0.18
88 0.18
89 0.22
90 0.24
91 0.23
92 0.23
93 0.23
94 0.27
95 0.28
96 0.28
97 0.27
98 0.25
99 0.3
100 0.35
101 0.43
102 0.48
103 0.5
104 0.51
105 0.54
106 0.54
107 0.56
108 0.59
109 0.58
110 0.55
111 0.6
112 0.66
113 0.7
114 0.72
115 0.7
116 0.69
117 0.68
118 0.69
119 0.62
120 0.59
121 0.52
122 0.47
123 0.42
124 0.34
125 0.25
126 0.22
127 0.2
128 0.16
129 0.14
130 0.13
131 0.11
132 0.11
133 0.12
134 0.12
135 0.11
136 0.1
137 0.11
138 0.11
139 0.1
140 0.1
141 0.09
142 0.07
143 0.08
144 0.08
145 0.07
146 0.07
147 0.08
148 0.09
149 0.09
150 0.1
151 0.1
152 0.12
153 0.14
154 0.17
155 0.19
156 0.25
157 0.28
158 0.29
159 0.31
160 0.3
161 0.29
162 0.32
163 0.35
164 0.36
165 0.33
166 0.34
167 0.32
168 0.32
169 0.31
170 0.27
171 0.21
172 0.13
173 0.12
174 0.09
175 0.09
176 0.07
177 0.07
178 0.07
179 0.09
180 0.1
181 0.1
182 0.11
183 0.11
184 0.14
185 0.15
186 0.16
187 0.15
188 0.2
189 0.31
190 0.34
191 0.4
192 0.43
193 0.48
194 0.51
195 0.58
196 0.62
197 0.62
198 0.67
199 0.7
200 0.7
201 0.74
202 0.71
203 0.68
204 0.61
205 0.6
206 0.58
207 0.5
208 0.44
209 0.37
210 0.35
211 0.31
212 0.3
213 0.24
214 0.2
215 0.21
216 0.19
217 0.2
218 0.22
219 0.24
220 0.24
221 0.23
222 0.23
223 0.27
224 0.28
225 0.24
226 0.24
227 0.22
228 0.23
229 0.2
230 0.16
231 0.13
232 0.11
233 0.11
234 0.11
235 0.13
236 0.13
237 0.14
238 0.15
239 0.15
240 0.2
241 0.2
242 0.19
243 0.17
244 0.14
245 0.13
246 0.17
247 0.23
248 0.2
249 0.21
250 0.22
251 0.22
252 0.24
253 0.23
254 0.19
255 0.13
256 0.12
257 0.11
258 0.1
259 0.1
260 0.08
261 0.08
262 0.07
263 0.07
264 0.06
265 0.06
266 0.06
267 0.08
268 0.1
269 0.1
270 0.1
271 0.1
272 0.14
273 0.15
274 0.16
275 0.14
276 0.15
277 0.19
278 0.2
279 0.2
280 0.18
281 0.19
282 0.21
283 0.22
284 0.2
285 0.22
286 0.25
287 0.33
288 0.37
289 0.36
290 0.38
291 0.42
292 0.45
293 0.45
294 0.5
295 0.43
296 0.49
297 0.55
298 0.54
299 0.56
300 0.56
301 0.54
302 0.54
303 0.62
304 0.61
305 0.62
306 0.68
307 0.71
308 0.78
309 0.85
310 0.85
311 0.85
312 0.85
313 0.87
314 0.86
315 0.84
316 0.84
317 0.85
318 0.86
319 0.87
320 0.85
321 0.84
322 0.81
323 0.8
324 0.76
325 0.74
326 0.74
327 0.72
328 0.7
329 0.7
330 0.68
331 0.69
332 0.67
333 0.59
334 0.49
335 0.41
336 0.38
337 0.3
338 0.26
339 0.19
340 0.17
341 0.21
342 0.29
343 0.39
344 0.48
345 0.58
346 0.68
347 0.78
348 0.86
349 0.92
350 0.93
351 0.94
352 0.94
353 0.93
354 0.87
355 0.81
356 0.8
357 0.73
358 0.67
359 0.62
360 0.57
361 0.53
362 0.49
363 0.48
364 0.49
365 0.53
366 0.54
367 0.58
368 0.62
369 0.63
370 0.69
371 0.7
372 0.68
373 0.67
374 0.67
375 0.59
376 0.55
377 0.56
378 0.5
379 0.46
380 0.42
381 0.36
382 0.33
383 0.36
384 0.37
385 0.32
386 0.33
387 0.35
388 0.37
389 0.4
390 0.44
391 0.47
392 0.47
393 0.5
394 0.51
395 0.5
396 0.46
397 0.42
398 0.45
399 0.45
400 0.42
401 0.43
402 0.44
403 0.43
404 0.46
405 0.51
406 0.52
407 0.55
408 0.59
409 0.59
410 0.59
411 0.63
412 0.61
413 0.53
414 0.45
415 0.36
416 0.34
417 0.27
418 0.23
419 0.21
420 0.2
421 0.23
422 0.25
423 0.28
424 0.27
425 0.31
426 0.31
427 0.29
428 0.35
429 0.34
430 0.32
431 0.35
432 0.32
433 0.34
434 0.4
435 0.38
436 0.33
437 0.34
438 0.35
439 0.36
440 0.43
441 0.45
442 0.48
443 0.57
444 0.6
445 0.63
446 0.64
447 0.61
448 0.61
449 0.57
450 0.58
451 0.58
452 0.61
453 0.56
454 0.57
455 0.57
456 0.49
457 0.45
458 0.35
459 0.31
460 0.22
461 0.22
462 0.17
463 0.13
464 0.13
465 0.13
466 0.12
467 0.07
468 0.07