Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MUI6

Protein Details
Accession A0A067MUI6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
82-110AEWKARTRGAKPKKKSKKKEDSGEKSGRPBasic
NLS Segment(s)
PositionSequence
85-112KARTRGAKPKKKSKKKEDSGEKSGRPNL
Subcellular Location(s) mito 20, nucl 3.5, cyto_nucl 3.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035451  Ada-like_dom_sf  
Amino Acid Sequences MSTASRIYTLLGRDGVPYKSITPGTLGGYRRGRIYGRLDCPSALRAIAQGHYVRHRVFFADEATAIAAGYRPCGACMREKYAEWKARTRGAKPKKKSKKKEDSGEKSGRPNLKRSDESVTPVPGPPLPEIEERAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.2
4 0.2
5 0.18
6 0.21
7 0.21
8 0.18
9 0.18
10 0.19
11 0.21
12 0.25
13 0.25
14 0.28
15 0.32
16 0.32
17 0.31
18 0.32
19 0.29
20 0.29
21 0.35
22 0.36
23 0.37
24 0.4
25 0.4
26 0.37
27 0.38
28 0.33
29 0.26
30 0.18
31 0.12
32 0.11
33 0.11
34 0.11
35 0.13
36 0.13
37 0.14
38 0.17
39 0.2
40 0.19
41 0.19
42 0.18
43 0.16
44 0.16
45 0.15
46 0.13
47 0.11
48 0.11
49 0.1
50 0.09
51 0.08
52 0.07
53 0.05
54 0.05
55 0.04
56 0.05
57 0.05
58 0.05
59 0.06
60 0.08
61 0.1
62 0.14
63 0.18
64 0.23
65 0.25
66 0.25
67 0.3
68 0.37
69 0.43
70 0.4
71 0.43
72 0.41
73 0.46
74 0.49
75 0.49
76 0.51
77 0.55
78 0.62
79 0.64
80 0.73
81 0.77
82 0.84
83 0.9
84 0.9
85 0.91
86 0.91
87 0.93
88 0.93
89 0.91
90 0.89
91 0.87
92 0.79
93 0.74
94 0.71
95 0.68
96 0.59
97 0.58
98 0.56
99 0.56
100 0.55
101 0.53
102 0.53
103 0.48
104 0.51
105 0.48
106 0.43
107 0.37
108 0.35
109 0.33
110 0.27
111 0.27
112 0.23
113 0.22
114 0.22
115 0.24