Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067ML23

Protein Details
Accession A0A067ML23   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
4-35LFRWISRSLRDRPQRQRPHPRRDRASRWFRLPHydrophilic
NLS Segment(s)
PositionSequence
13-43RDRPQRQRPHPRRDRASRWFRLPPRKKSMTR
Subcellular Location(s) nucl 13, mito_nucl 12.333, mito 10.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MGTLFRWISRSLRDRPQRQRPHPRRDRASRWFRLPPRKKSMTRRTRVDQYCAAILRPFSVLLDLPSSLLLYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.71
3 0.79
4 0.81
5 0.85
6 0.9
7 0.9
8 0.91
9 0.91
10 0.91
11 0.9
12 0.88
13 0.87
14 0.86
15 0.86
16 0.81
17 0.77
18 0.75
19 0.73
20 0.75
21 0.74
22 0.73
23 0.71
24 0.73
25 0.74
26 0.77
27 0.8
28 0.79
29 0.78
30 0.77
31 0.75
32 0.77
33 0.73
34 0.67
35 0.6
36 0.52
37 0.49
38 0.42
39 0.36
40 0.28
41 0.24
42 0.2
43 0.17
44 0.14
45 0.1
46 0.11
47 0.11
48 0.11
49 0.13
50 0.12
51 0.11
52 0.11