Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MMM4

Protein Details
Accession A0A067MMM4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
138-172FPPIPLLLRCRRRRLRPRLPRRRPARRTTSQSVGLHydrophilic
NLS Segment(s)
PositionSequence
148-164RRRRLRPRLPRRRPARR
Subcellular Location(s) mito 16, nucl 10.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MHPGFTPPPAYTRIQRLSLLSIKRKAIRRLPGPQSLPPPLAFLQSTPYKTPYALAPFLSRPLQHTNLLAGRASRKLPHTLSPKPCLADPLPPRLSCIPVPHPDESLGNTLVPLPRRLFSSQKIVSRAAKLHLPCTLLFPPIPLLLRCRRRRLRPRLPRRRPARRTTSQSVGLGTGRAGYHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.41
4 0.43
5 0.46
6 0.49
7 0.47
8 0.48
9 0.5
10 0.55
11 0.6
12 0.62
13 0.64
14 0.65
15 0.66
16 0.7
17 0.71
18 0.73
19 0.7
20 0.67
21 0.64
22 0.59
23 0.53
24 0.43
25 0.39
26 0.31
27 0.29
28 0.24
29 0.18
30 0.2
31 0.22
32 0.25
33 0.23
34 0.25
35 0.23
36 0.23
37 0.24
38 0.23
39 0.24
40 0.22
41 0.22
42 0.22
43 0.22
44 0.25
45 0.26
46 0.21
47 0.19
48 0.24
49 0.25
50 0.24
51 0.24
52 0.24
53 0.24
54 0.25
55 0.21
56 0.17
57 0.16
58 0.17
59 0.17
60 0.16
61 0.17
62 0.2
63 0.22
64 0.28
65 0.33
66 0.39
67 0.44
68 0.46
69 0.45
70 0.41
71 0.4
72 0.36
73 0.29
74 0.29
75 0.27
76 0.31
77 0.32
78 0.31
79 0.33
80 0.3
81 0.32
82 0.25
83 0.27
84 0.23
85 0.26
86 0.3
87 0.28
88 0.29
89 0.27
90 0.26
91 0.23
92 0.21
93 0.16
94 0.12
95 0.11
96 0.11
97 0.13
98 0.13
99 0.14
100 0.13
101 0.13
102 0.17
103 0.2
104 0.23
105 0.24
106 0.33
107 0.35
108 0.39
109 0.41
110 0.41
111 0.41
112 0.4
113 0.39
114 0.31
115 0.31
116 0.27
117 0.26
118 0.26
119 0.25
120 0.22
121 0.26
122 0.25
123 0.21
124 0.2
125 0.19
126 0.18
127 0.18
128 0.2
129 0.15
130 0.2
131 0.28
132 0.38
133 0.44
134 0.53
135 0.6
136 0.69
137 0.8
138 0.85
139 0.87
140 0.88
141 0.92
142 0.93
143 0.95
144 0.94
145 0.94
146 0.94
147 0.92
148 0.91
149 0.9
150 0.89
151 0.87
152 0.85
153 0.81
154 0.76
155 0.68
156 0.6
157 0.52
158 0.42
159 0.34
160 0.26
161 0.21