Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067LT07

Protein Details
Accession A0A067LT07    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
79-100VGRTRFSRRNWRAGKNHERQISHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, cyto_pero 7.5, nucl 6, mito 6, mito_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012933  HicA_mRNA_interferase  
Gene Ontology GO:0003729  F:mRNA binding  
Pfam View protein in Pfam  
PF07927  HicA_toxin  
Amino Acid Sequences MFHRLFGGEEKTSQIRWSDFEKFISQLGFDVVEAEGSSVRFDPPVQNARPITFHRPHPDSTLTPMLIKWCVHDSNDVMVGRTRFSRRNWRAGKNHERQISFLAHGLMEIDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.22
4 0.27
5 0.29
6 0.29
7 0.32
8 0.32
9 0.3
10 0.29
11 0.27
12 0.21
13 0.15
14 0.14
15 0.11
16 0.08
17 0.08
18 0.07
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.07
29 0.09
30 0.14
31 0.21
32 0.21
33 0.26
34 0.26
35 0.27
36 0.3
37 0.31
38 0.33
39 0.3
40 0.33
41 0.34
42 0.36
43 0.36
44 0.36
45 0.37
46 0.3
47 0.31
48 0.3
49 0.24
50 0.22
51 0.21
52 0.19
53 0.18
54 0.17
55 0.14
56 0.14
57 0.15
58 0.15
59 0.18
60 0.17
61 0.17
62 0.22
63 0.21
64 0.18
65 0.19
66 0.19
67 0.18
68 0.21
69 0.23
70 0.23
71 0.29
72 0.4
73 0.43
74 0.54
75 0.61
76 0.66
77 0.71
78 0.77
79 0.82
80 0.8
81 0.82
82 0.79
83 0.72
84 0.64
85 0.59
86 0.52
87 0.43
88 0.36
89 0.28
90 0.21
91 0.19