Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067LR15

Protein Details
Accession A0A067LR15    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-121AEAPPVKRKRGRPPGSKNKPKAAERKPRRPRGRPPKLRPPGEEDTAKSKEPKKRGRPPKKKLKTDNTERDDKDBasic
NLS Segment(s)
PositionSequence
52-111PPVKRKRGRPPGSKNKPKAAERKPRRPRGRPPKLRPPGEEDTAKSKEPKKRGRPPKKKLK
137-146RPRGRPPKKT
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MPPKRKNPKDEDEDEDTQVIANEGDGDGGEEVSAPANDSAVDAHLAPPAEAPPVKRKRGRPPGSKNKPKAAERKPRRPRGRPPKLRPPGEEDTAKSKEPKKRGRPPKKKLKTDNTERDDKDQSGHNESAAGPNMGERPRGRPPKKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.51
3 0.4
4 0.32
5 0.26
6 0.19
7 0.1
8 0.07
9 0.06
10 0.05
11 0.05
12 0.05
13 0.06
14 0.05
15 0.05
16 0.05
17 0.04
18 0.05
19 0.05
20 0.06
21 0.06
22 0.05
23 0.05
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.08
32 0.08
33 0.08
34 0.08
35 0.08
36 0.1
37 0.1
38 0.12
39 0.21
40 0.28
41 0.35
42 0.41
43 0.48
44 0.57
45 0.67
46 0.74
47 0.74
48 0.78
49 0.83
50 0.88
51 0.9
52 0.85
53 0.81
54 0.79
55 0.75
56 0.74
57 0.72
58 0.73
59 0.72
60 0.78
61 0.8
62 0.83
63 0.86
64 0.85
65 0.86
66 0.86
67 0.88
68 0.88
69 0.87
70 0.87
71 0.87
72 0.84
73 0.75
74 0.72
75 0.65
76 0.59
77 0.52
78 0.43
79 0.41
80 0.39
81 0.37
82 0.34
83 0.35
84 0.38
85 0.45
86 0.54
87 0.58
88 0.66
89 0.76
90 0.83
91 0.88
92 0.91
93 0.93
94 0.93
95 0.93
96 0.93
97 0.92
98 0.91
99 0.91
100 0.91
101 0.86
102 0.84
103 0.76
104 0.71
105 0.64
106 0.55
107 0.46
108 0.42
109 0.41
110 0.38
111 0.36
112 0.31
113 0.28
114 0.28
115 0.3
116 0.25
117 0.21
118 0.14
119 0.15
120 0.2
121 0.2
122 0.25
123 0.22
124 0.26
125 0.37
126 0.48
127 0.52