Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MIP6

Protein Details
Accession A0A067MIP6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-121PLDLRPKKTRAIRRRLTRHEKSLKTLKQRKRDIHFPTRKYBasic
NLS Segment(s)
PositionSequence
85-116LRPKKTRAIRRRLTRHEKSLKTLKQRKRDIHF
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPSTKVKAYELQSKSKPDLAKQLAELKTELSSLRVQKIAGGSAAKLTKINTVRKSIARVLTVTNQKARQNLREFYKNKKYLPLDLRPKKTRAIRRRLTRHEKSLKTLKQRKRDIHFPTRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.51
4 0.44
5 0.5
6 0.46
7 0.44
8 0.42
9 0.47
10 0.43
11 0.42
12 0.39
13 0.3
14 0.25
15 0.23
16 0.2
17 0.13
18 0.16
19 0.17
20 0.2
21 0.19
22 0.19
23 0.2
24 0.21
25 0.19
26 0.16
27 0.14
28 0.11
29 0.14
30 0.15
31 0.13
32 0.13
33 0.12
34 0.17
35 0.22
36 0.29
37 0.29
38 0.33
39 0.36
40 0.37
41 0.41
42 0.38
43 0.36
44 0.3
45 0.27
46 0.25
47 0.27
48 0.3
49 0.28
50 0.27
51 0.28
52 0.29
53 0.33
54 0.33
55 0.35
56 0.36
57 0.39
58 0.4
59 0.46
60 0.46
61 0.51
62 0.58
63 0.56
64 0.52
65 0.55
66 0.52
67 0.51
68 0.57
69 0.57
70 0.58
71 0.62
72 0.7
73 0.66
74 0.66
75 0.65
76 0.67
77 0.68
78 0.67
79 0.69
80 0.7
81 0.76
82 0.84
83 0.88
84 0.89
85 0.87
86 0.87
87 0.86
88 0.81
89 0.78
90 0.78
91 0.75
92 0.76
93 0.77
94 0.76
95 0.76
96 0.82
97 0.83
98 0.81
99 0.83
100 0.82
101 0.83
102 0.84
103 0.79
104 0.77
105 0.76