Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QCJ1

Protein Details
Accession B6QCJ1    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-45LKGSKVKDGRIDKTKKKKKKAEPEGATATBasic
83-105EAERKHEEQRKKRLNDRLRREGVBasic
NLS Segment(s)
PositionSequence
13-37GKLKLKGSKVKDGRIDKTKKKKKKA
86-106RKHEEQRKKRLNDRLRREGVK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG tmf:PMAA_067440  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSDEYAAISGGGKLKLKGSKVKDGRIDKTKKKKKKAEPEGATATTGKEAEEEALDGPNDAIDKKLDEELSDSGEKRVVFKTEAERKHEEQRKKRLNDRLRREGVKTHKERVEELNRYLSTLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.21
3 0.25
4 0.28
5 0.35
6 0.38
7 0.46
8 0.51
9 0.57
10 0.61
11 0.64
12 0.68
13 0.69
14 0.72
15 0.72
16 0.77
17 0.81
18 0.82
19 0.85
20 0.88
21 0.88
22 0.91
23 0.92
24 0.91
25 0.86
26 0.83
27 0.79
28 0.69
29 0.6
30 0.48
31 0.37
32 0.27
33 0.22
34 0.14
35 0.08
36 0.07
37 0.07
38 0.07
39 0.07
40 0.06
41 0.07
42 0.06
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.08
53 0.08
54 0.08
55 0.1
56 0.1
57 0.12
58 0.13
59 0.12
60 0.11
61 0.14
62 0.13
63 0.13
64 0.14
65 0.13
66 0.13
67 0.15
68 0.24
69 0.31
70 0.35
71 0.39
72 0.43
73 0.45
74 0.54
75 0.6
76 0.61
77 0.61
78 0.68
79 0.72
80 0.74
81 0.78
82 0.79
83 0.81
84 0.82
85 0.82
86 0.81
87 0.79
88 0.76
89 0.7
90 0.68
91 0.68
92 0.68
93 0.64
94 0.62
95 0.58
96 0.56
97 0.57
98 0.57
99 0.58
100 0.52
101 0.5
102 0.51
103 0.47
104 0.46
105 0.43
106 0.34
107 0.27
108 0.23
109 0.24
110 0.19
111 0.2
112 0.21
113 0.26
114 0.26