Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6Q6A4

Protein Details
Accession B6Q6A4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
55-76GISKKKATKKLTRSQRLRQQKGHydrophilic
NLS Segment(s)
PositionSequence
58-67KKKATKKLTR
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
KEGG tmf:PMAA_033820  -  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MVRTGKLKKKSTSVHSRAARRGNSPSDVDRSLESMSRVEAPTKAAGVLAAHANAGISKKKATKKLTRSQRLRQQKGIERGEMLFDRLETKVEKAKTSYSKVANARKVQWEDLSGKQAKAAKILQQTQHNDDERMEEDEKVSSAAPITSNKPAFTTPVASSLPPVEPAAVDDDDNIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.77
4 0.76
5 0.76
6 0.7
7 0.63
8 0.64
9 0.59
10 0.55
11 0.51
12 0.47
13 0.44
14 0.42
15 0.38
16 0.32
17 0.29
18 0.26
19 0.23
20 0.2
21 0.15
22 0.15
23 0.17
24 0.17
25 0.17
26 0.16
27 0.16
28 0.16
29 0.16
30 0.15
31 0.11
32 0.11
33 0.09
34 0.1
35 0.08
36 0.07
37 0.06
38 0.06
39 0.06
40 0.07
41 0.08
42 0.09
43 0.09
44 0.12
45 0.19
46 0.25
47 0.34
48 0.41
49 0.49
50 0.57
51 0.66
52 0.74
53 0.78
54 0.8
55 0.81
56 0.83
57 0.84
58 0.8
59 0.76
60 0.73
61 0.71
62 0.72
63 0.66
64 0.56
65 0.46
66 0.41
67 0.37
68 0.29
69 0.22
70 0.13
71 0.1
72 0.1
73 0.09
74 0.1
75 0.08
76 0.1
77 0.14
78 0.15
79 0.16
80 0.15
81 0.21
82 0.25
83 0.29
84 0.33
85 0.3
86 0.36
87 0.42
88 0.48
89 0.49
90 0.48
91 0.47
92 0.47
93 0.48
94 0.43
95 0.37
96 0.33
97 0.3
98 0.29
99 0.32
100 0.27
101 0.25
102 0.26
103 0.29
104 0.26
105 0.27
106 0.26
107 0.25
108 0.3
109 0.35
110 0.37
111 0.41
112 0.44
113 0.45
114 0.5
115 0.46
116 0.4
117 0.36
118 0.34
119 0.28
120 0.29
121 0.25
122 0.19
123 0.18
124 0.18
125 0.17
126 0.15
127 0.13
128 0.09
129 0.08
130 0.09
131 0.1
132 0.12
133 0.16
134 0.23
135 0.24
136 0.25
137 0.26
138 0.26
139 0.27
140 0.26
141 0.28
142 0.21
143 0.25
144 0.26
145 0.24
146 0.25
147 0.24
148 0.23
149 0.2
150 0.19
151 0.14
152 0.13
153 0.14
154 0.17
155 0.16
156 0.15