Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MK25

Protein Details
Accession A0A067MK25   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
40-70SCAVPRRCLHRRHQRRYRRRHRWSCCQSWLAHydrophilic
NLS Segment(s)
PositionSequence
53-59QRRYRRR
Subcellular Location(s) mito 19, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MFQSFRLVHRTSCLALPRFVRGPPPFLVNALPLALCVTPSCAVPRRCLHRRHQRRYRRRHRWSCCQSWLASFSHLRLLRCSGDRTECWTPCPAAKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.34
4 0.35
5 0.34
6 0.33
7 0.37
8 0.31
9 0.33
10 0.3
11 0.32
12 0.27
13 0.26
14 0.26
15 0.19
16 0.18
17 0.14
18 0.12
19 0.08
20 0.09
21 0.07
22 0.07
23 0.06
24 0.07
25 0.07
26 0.08
27 0.11
28 0.17
29 0.18
30 0.23
31 0.28
32 0.34
33 0.41
34 0.46
35 0.54
36 0.58
37 0.68
38 0.74
39 0.79
40 0.82
41 0.86
42 0.92
43 0.93
44 0.93
45 0.93
46 0.93
47 0.91
48 0.92
49 0.9
50 0.87
51 0.82
52 0.74
53 0.64
54 0.56
55 0.5
56 0.4
57 0.35
58 0.27
59 0.22
60 0.27
61 0.29
62 0.27
63 0.26
64 0.29
65 0.29
66 0.32
67 0.34
68 0.3
69 0.33
70 0.34
71 0.4
72 0.45
73 0.41
74 0.41
75 0.42
76 0.4