Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QLF3

Protein Details
Accession B6QLF3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
223-242HKALEKTKTMKEKFRRSTEAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
KEGG tmf:PMAA_057190  -  
Amino Acid Sequences MRSSTLLAVLMAAIAQGQSTSGQSMTTSPASSGSASSTHIPLFGVGATTIPISGVAGSIVGADSTATTIALNCNNGTPCVLGTNPITLTQGRSTWVADIVTQASIEGRSATVTAAVACKIISSTQAATCTATVTIGVEAQGQSSALTITTTTSLASSQINYEQLLITAGVEKLNNPSAAQTPSGAAGLVLAPVPTGNMAIGVGGMAAAAVVAVAADCLPMQCHKALEKTKTMKEKFRRSTEAISLKTLRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.04
5 0.05
6 0.06
7 0.07
8 0.07
9 0.08
10 0.08
11 0.1
12 0.13
13 0.14
14 0.14
15 0.13
16 0.14
17 0.16
18 0.16
19 0.15
20 0.13
21 0.12
22 0.13
23 0.15
24 0.15
25 0.14
26 0.14
27 0.13
28 0.12
29 0.11
30 0.09
31 0.08
32 0.06
33 0.06
34 0.07
35 0.06
36 0.06
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.07
57 0.09
58 0.1
59 0.09
60 0.12
61 0.12
62 0.13
63 0.13
64 0.11
65 0.1
66 0.1
67 0.1
68 0.1
69 0.1
70 0.12
71 0.12
72 0.12
73 0.13
74 0.12
75 0.14
76 0.14
77 0.13
78 0.13
79 0.13
80 0.13
81 0.12
82 0.13
83 0.11
84 0.09
85 0.1
86 0.09
87 0.08
88 0.07
89 0.07
90 0.06
91 0.06
92 0.06
93 0.05
94 0.04
95 0.04
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.06
110 0.07
111 0.08
112 0.09
113 0.09
114 0.1
115 0.1
116 0.09
117 0.08
118 0.07
119 0.05
120 0.05
121 0.05
122 0.04
123 0.04
124 0.05
125 0.05
126 0.05
127 0.05
128 0.04
129 0.04
130 0.04
131 0.04
132 0.03
133 0.04
134 0.04
135 0.04
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.07
142 0.07
143 0.07
144 0.07
145 0.09
146 0.1
147 0.1
148 0.1
149 0.09
150 0.08
151 0.09
152 0.07
153 0.06
154 0.06
155 0.07
156 0.07
157 0.07
158 0.07
159 0.09
160 0.12
161 0.12
162 0.11
163 0.12
164 0.15
165 0.16
166 0.17
167 0.14
168 0.12
169 0.13
170 0.13
171 0.11
172 0.08
173 0.06
174 0.06
175 0.05
176 0.05
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.03
189 0.03
190 0.03
191 0.02
192 0.02
193 0.02
194 0.02
195 0.01
196 0.01
197 0.01
198 0.01
199 0.01
200 0.02
201 0.02
202 0.02
203 0.03
204 0.03
205 0.05
206 0.07
207 0.09
208 0.11
209 0.14
210 0.17
211 0.26
212 0.33
213 0.38
214 0.46
215 0.52
216 0.59
217 0.67
218 0.69
219 0.71
220 0.74
221 0.79
222 0.79
223 0.8
224 0.79
225 0.75
226 0.77
227 0.76
228 0.75
229 0.66
230 0.64
231 0.58