Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067LUL6

Protein Details
Accession A0A067LUL6   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MERTVAKERQRARRRRAMTTMRQGEGHydrophilic
NLS Segment(s)
PositionSequence
11-15RARRR
44-48RKKRR
Subcellular Location(s) nucl 8, mito 7.5, cyto_mito 6.5, cyto 4.5, plas 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MERTVAKERQRARRRRAMTTMRQGEGDGEQYYVIARTREDDGERKKRRGAKTITTMGDPTTSGGVVTAHACLRSTTTVPPPLILSASDHGSAYPLPPPPIAIQCSLRCPAQRLSSHAPTLSSSFAWRHAASKAARSWSITWHSGRLYWRPSQVASPSPLGPRIICTLYSLTLYELYTSFDPPPPVLLPLILKVLTTSRGPSIIACPSGRPSSSTPRPAPGSRSPAHRSRFSWSVSPTQPGSRRPTYFSQSSAASPLSCSYLLWLIAGRTHGPSRPNSPRRNQWLWRSLLYCAQLRRLALVGPLYVTAGVVSFLFLFPWCPAMLARYEHSPLVGRVLMYDISALVLPLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.84
4 0.83
5 0.83
6 0.84
7 0.82
8 0.73
9 0.67
10 0.58
11 0.5
12 0.41
13 0.34
14 0.23
15 0.16
16 0.14
17 0.13
18 0.13
19 0.13
20 0.13
21 0.1
22 0.1
23 0.12
24 0.16
25 0.2
26 0.24
27 0.31
28 0.4
29 0.5
30 0.57
31 0.6
32 0.63
33 0.68
34 0.71
35 0.73
36 0.71
37 0.7
38 0.71
39 0.75
40 0.7
41 0.63
42 0.57
43 0.47
44 0.4
45 0.3
46 0.21
47 0.14
48 0.11
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.12
60 0.14
61 0.15
62 0.17
63 0.22
64 0.28
65 0.28
66 0.28
67 0.27
68 0.25
69 0.24
70 0.2
71 0.17
72 0.13
73 0.15
74 0.14
75 0.13
76 0.12
77 0.13
78 0.13
79 0.1
80 0.12
81 0.13
82 0.14
83 0.14
84 0.15
85 0.17
86 0.21
87 0.22
88 0.21
89 0.24
90 0.25
91 0.29
92 0.29
93 0.29
94 0.26
95 0.28
96 0.3
97 0.32
98 0.33
99 0.36
100 0.42
101 0.44
102 0.45
103 0.41
104 0.37
105 0.3
106 0.29
107 0.23
108 0.16
109 0.13
110 0.13
111 0.15
112 0.17
113 0.16
114 0.16
115 0.16
116 0.21
117 0.2
118 0.25
119 0.25
120 0.25
121 0.26
122 0.26
123 0.26
124 0.26
125 0.29
126 0.27
127 0.25
128 0.24
129 0.24
130 0.25
131 0.27
132 0.27
133 0.26
134 0.26
135 0.28
136 0.27
137 0.27
138 0.27
139 0.27
140 0.25
141 0.23
142 0.22
143 0.21
144 0.21
145 0.21
146 0.19
147 0.17
148 0.15
149 0.15
150 0.14
151 0.12
152 0.12
153 0.12
154 0.12
155 0.12
156 0.11
157 0.09
158 0.09
159 0.09
160 0.08
161 0.07
162 0.08
163 0.08
164 0.09
165 0.1
166 0.1
167 0.11
168 0.1
169 0.12
170 0.11
171 0.11
172 0.1
173 0.1
174 0.08
175 0.09
176 0.1
177 0.08
178 0.08
179 0.07
180 0.08
181 0.09
182 0.09
183 0.09
184 0.08
185 0.09
186 0.09
187 0.1
188 0.12
189 0.12
190 0.14
191 0.13
192 0.13
193 0.16
194 0.17
195 0.17
196 0.17
197 0.19
198 0.26
199 0.33
200 0.39
201 0.38
202 0.41
203 0.45
204 0.44
205 0.47
206 0.44
207 0.44
208 0.4
209 0.46
210 0.46
211 0.49
212 0.52
213 0.5
214 0.46
215 0.44
216 0.46
217 0.41
218 0.42
219 0.37
220 0.4
221 0.37
222 0.38
223 0.34
224 0.36
225 0.38
226 0.39
227 0.43
228 0.42
229 0.43
230 0.44
231 0.48
232 0.47
233 0.45
234 0.42
235 0.37
236 0.32
237 0.31
238 0.28
239 0.23
240 0.17
241 0.16
242 0.14
243 0.14
244 0.12
245 0.11
246 0.1
247 0.12
248 0.11
249 0.11
250 0.11
251 0.09
252 0.11
253 0.12
254 0.12
255 0.13
256 0.15
257 0.17
258 0.2
259 0.24
260 0.31
261 0.41
262 0.5
263 0.55
264 0.62
265 0.69
266 0.74
267 0.8
268 0.78
269 0.77
270 0.76
271 0.72
272 0.69
273 0.61
274 0.53
275 0.49
276 0.45
277 0.4
278 0.34
279 0.35
280 0.33
281 0.31
282 0.31
283 0.27
284 0.24
285 0.21
286 0.21
287 0.16
288 0.13
289 0.13
290 0.12
291 0.11
292 0.1
293 0.07
294 0.06
295 0.06
296 0.05
297 0.05
298 0.05
299 0.06
300 0.06
301 0.06
302 0.08
303 0.08
304 0.1
305 0.09
306 0.1
307 0.1
308 0.12
309 0.16
310 0.18
311 0.21
312 0.24
313 0.26
314 0.25
315 0.26
316 0.27
317 0.24
318 0.25
319 0.24
320 0.19
321 0.17
322 0.2
323 0.18
324 0.15
325 0.15
326 0.1
327 0.09
328 0.09