Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067M8I9

Protein Details
Accession A0A067M8I9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-114DAEAGKRENHKKLRKDNRERIKMSNFMHydrophilic
NLS Segment(s)
PositionSequence
93-106KRENHKKLRKDNRE
Subcellular Location(s) mito 16.5, mito_nucl 13, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MNALRRSSALFSSFSSSSRQCAPRFYSAKAPESNATSGTASVASSCPENTILTGIAYLKNQTPVVALPDAEYPPWLWTLLTPKQPSADAEAGKRENHKKLRKDNRERIKMSNFMKSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.23
4 0.23
5 0.29
6 0.34
7 0.3
8 0.35
9 0.4
10 0.44
11 0.47
12 0.47
13 0.49
14 0.49
15 0.53
16 0.49
17 0.46
18 0.39
19 0.39
20 0.37
21 0.28
22 0.25
23 0.19
24 0.17
25 0.14
26 0.12
27 0.08
28 0.08
29 0.08
30 0.06
31 0.07
32 0.07
33 0.07
34 0.08
35 0.08
36 0.07
37 0.08
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.08
45 0.07
46 0.09
47 0.09
48 0.08
49 0.09
50 0.08
51 0.11
52 0.1
53 0.1
54 0.09
55 0.1
56 0.11
57 0.1
58 0.1
59 0.08
60 0.08
61 0.09
62 0.08
63 0.06
64 0.08
65 0.15
66 0.2
67 0.26
68 0.27
69 0.27
70 0.29
71 0.3
72 0.29
73 0.29
74 0.28
75 0.23
76 0.24
77 0.3
78 0.3
79 0.31
80 0.38
81 0.38
82 0.42
83 0.5
84 0.58
85 0.61
86 0.7
87 0.8
88 0.84
89 0.88
90 0.9
91 0.91
92 0.92
93 0.87
94 0.84
95 0.8
96 0.78
97 0.7