Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067N9W1

Protein Details
Accession A0A067N9W1    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-44ANLRAFAGVRRRRRRRRVKRTLSAMACHydrophilic
NLS Segment(s)
PositionSequence
25-37GVRRRRRRRRVKR
Subcellular Location(s) mito 20, nucl 3, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MTSPWQPRRTLRAALFAANLRAFAGVRRRRRRRRVKRTLSAMACDVGEPMSCKNKIRSRSRTSVYASILWSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.45
3 0.38
4 0.35
5 0.27
6 0.24
7 0.15
8 0.14
9 0.12
10 0.12
11 0.21
12 0.26
13 0.36
14 0.47
15 0.58
16 0.68
17 0.79
18 0.88
19 0.89
20 0.93
21 0.94
22 0.93
23 0.92
24 0.89
25 0.87
26 0.77
27 0.68
28 0.57
29 0.46
30 0.35
31 0.26
32 0.18
33 0.1
34 0.08
35 0.07
36 0.09
37 0.15
38 0.16
39 0.19
40 0.27
41 0.34
42 0.42
43 0.52
44 0.59
45 0.62
46 0.7
47 0.72
48 0.71
49 0.7
50 0.67
51 0.61
52 0.54
53 0.48