Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067M4D1

Protein Details
Accession A0A067M4D1   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-46QLTRPSTKIKTKQAKVKPMKGKVATHydrophilic
NLS Segment(s)
PositionSequence
29-61KIKTKQAKVKPMKGKVATGGKAAKDSKSTKSKR
Subcellular Location(s) nucl 17.5, mito_nucl 13.166, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MACSNATSSSSSTKCKPPSSPQLTRPSTKIKTKQAKVKPMKGKVATGGKAAKDSKSTKSKRSADSDEESDPTLPKKRCQATVKDEPTPTAGASSNAPKILPKEELARCAKLLGFKSACWLNKDGTPKTLKEIQAMQIAAWNSDTYEHFEMPILVEYHGKYKYSFKCRARG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.53
4 0.55
5 0.63
6 0.68
7 0.72
8 0.72
9 0.76
10 0.76
11 0.73
12 0.68
13 0.66
14 0.63
15 0.64
16 0.64
17 0.65
18 0.7
19 0.74
20 0.8
21 0.79
22 0.83
23 0.83
24 0.84
25 0.83
26 0.8
27 0.81
28 0.73
29 0.66
30 0.62
31 0.61
32 0.52
33 0.47
34 0.43
35 0.34
36 0.37
37 0.36
38 0.3
39 0.28
40 0.3
41 0.33
42 0.4
43 0.44
44 0.46
45 0.54
46 0.6
47 0.6
48 0.64
49 0.62
50 0.57
51 0.57
52 0.54
53 0.45
54 0.39
55 0.34
56 0.27
57 0.22
58 0.19
59 0.22
60 0.2
61 0.21
62 0.28
63 0.3
64 0.38
65 0.42
66 0.47
67 0.48
68 0.57
69 0.58
70 0.55
71 0.52
72 0.44
73 0.41
74 0.34
75 0.26
76 0.17
77 0.13
78 0.09
79 0.1
80 0.12
81 0.12
82 0.12
83 0.12
84 0.11
85 0.12
86 0.14
87 0.15
88 0.14
89 0.2
90 0.21
91 0.29
92 0.31
93 0.31
94 0.28
95 0.27
96 0.27
97 0.23
98 0.24
99 0.24
100 0.21
101 0.2
102 0.24
103 0.28
104 0.3
105 0.28
106 0.28
107 0.23
108 0.26
109 0.33
110 0.31
111 0.31
112 0.33
113 0.31
114 0.34
115 0.39
116 0.36
117 0.33
118 0.35
119 0.33
120 0.34
121 0.34
122 0.28
123 0.25
124 0.24
125 0.21
126 0.19
127 0.15
128 0.1
129 0.12
130 0.13
131 0.15
132 0.18
133 0.18
134 0.17
135 0.18
136 0.18
137 0.17
138 0.2
139 0.15
140 0.13
141 0.15
142 0.16
143 0.2
144 0.22
145 0.22
146 0.2
147 0.28
148 0.37
149 0.44
150 0.53