Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067LUF6

Protein Details
Accession A0A067LUF6    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
43-72RSQQMPIRSRPPRQRQHRRQRLSSRRPPAGHydrophilic
NLS Segment(s)
PositionSequence
49-72IRSRPPRQRQHRRQRLSSRRPPAG
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 6.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MIAPRLPSLYLLLSPPVLEVRAQVVHDAETRRYTCGSHVFRRRSQQMPIRSRPPRQRQHRRQRLSSRRPPAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.1
5 0.09
6 0.08
7 0.1
8 0.12
9 0.12
10 0.12
11 0.12
12 0.12
13 0.15
14 0.17
15 0.15
16 0.17
17 0.18
18 0.18
19 0.18
20 0.17
21 0.17
22 0.24
23 0.28
24 0.32
25 0.4
26 0.44
27 0.48
28 0.55
29 0.58
30 0.52
31 0.55
32 0.54
33 0.56
34 0.6
35 0.63
36 0.65
37 0.66
38 0.72
39 0.75
40 0.77
41 0.77
42 0.8
43 0.85
44 0.86
45 0.91
46 0.94
47 0.92
48 0.92
49 0.93
50 0.93
51 0.93
52 0.92