Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MIG0

Protein Details
Accession A0A067MIG0   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
6-26IPIPNLTKKSRGRRVPTTPYVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences RTVLPIPIPNLTKKSRGRRVPTTPYVIQSGVPKNMRTFVCEANGCGACFQRGEHLKRHVRSIHTNDLPYPCTHPTCDKKFSRSDNLAQHMRVHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.67
4 0.71
5 0.75
6 0.8
7 0.81
8 0.78
9 0.75
10 0.67
11 0.6
12 0.55
13 0.45
14 0.37
15 0.33
16 0.31
17 0.3
18 0.29
19 0.28
20 0.26
21 0.31
22 0.3
23 0.27
24 0.27
25 0.22
26 0.25
27 0.24
28 0.23
29 0.21
30 0.22
31 0.19
32 0.16
33 0.14
34 0.1
35 0.1
36 0.1
37 0.13
38 0.18
39 0.21
40 0.26
41 0.35
42 0.42
43 0.43
44 0.49
45 0.46
46 0.45
47 0.51
48 0.52
49 0.53
50 0.49
51 0.49
52 0.46
53 0.45
54 0.42
55 0.35
56 0.31
57 0.25
58 0.24
59 0.25
60 0.31
61 0.38
62 0.43
63 0.51
64 0.52
65 0.55
66 0.61
67 0.66
68 0.67
69 0.64
70 0.65
71 0.65
72 0.68
73 0.66
74 0.59