Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MY95

Protein Details
Accession A0A067MY95   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-34KGSGLSRTRSRNKNRSASRTGRHydrophilic
NLS Segment(s)
PositionSequence
10-30KAAKGSGLSRTRSRNKNRSAS
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
Amino Acid Sequences MKIRSQRVAKAAKGSGLSRTRSRNKNRSASRTGRIRELSPGLISHTHTAQNTYACPQSLREYECESWREHHVSGFGVPAQIEGLRDREPDGDDEKQTEGHRSAFEQRLNAGEQELLSQWSGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.4
4 0.41
5 0.4
6 0.47
7 0.53
8 0.59
9 0.69
10 0.7
11 0.73
12 0.79
13 0.82
14 0.82
15 0.81
16 0.79
17 0.76
18 0.75
19 0.68
20 0.65
21 0.58
22 0.5
23 0.46
24 0.42
25 0.35
26 0.27
27 0.25
28 0.2
29 0.19
30 0.19
31 0.16
32 0.14
33 0.15
34 0.15
35 0.16
36 0.15
37 0.15
38 0.15
39 0.15
40 0.15
41 0.13
42 0.13
43 0.13
44 0.15
45 0.17
46 0.17
47 0.17
48 0.2
49 0.22
50 0.24
51 0.25
52 0.22
53 0.21
54 0.23
55 0.24
56 0.2
57 0.19
58 0.17
59 0.16
60 0.15
61 0.14
62 0.11
63 0.09
64 0.08
65 0.07
66 0.07
67 0.06
68 0.07
69 0.07
70 0.1
71 0.1
72 0.11
73 0.12
74 0.13
75 0.14
76 0.16
77 0.2
78 0.21
79 0.21
80 0.22
81 0.22
82 0.23
83 0.23
84 0.24
85 0.21
86 0.21
87 0.21
88 0.22
89 0.29
90 0.32
91 0.34
92 0.31
93 0.31
94 0.31
95 0.32
96 0.29
97 0.23
98 0.17
99 0.15
100 0.15
101 0.15
102 0.13