Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067M2Z9

Protein Details
Accession A0A067M2Z9    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-79FLIMACCTSKHPRKKTRCAVDTRGFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 9.5, plas 6, nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRHMPSRSPAVSTCFMSEAFVCMGLFMGSQLWLVAFFKVSDINSDNLFSGSRAFLIMACCTSKHPRKKTRCAVDTRGFLGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.22
4 0.2
5 0.16
6 0.13
7 0.12
8 0.1
9 0.08
10 0.08
11 0.07
12 0.07
13 0.05
14 0.05
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.05
22 0.05
23 0.04
24 0.05
25 0.06
26 0.06
27 0.08
28 0.09
29 0.1
30 0.1
31 0.11
32 0.11
33 0.1
34 0.1
35 0.08
36 0.08
37 0.07
38 0.07
39 0.06
40 0.06
41 0.07
42 0.08
43 0.09
44 0.09
45 0.1
46 0.1
47 0.14
48 0.24
49 0.32
50 0.41
51 0.51
52 0.6
53 0.7
54 0.8
55 0.87
56 0.89
57 0.88
58 0.87
59 0.86
60 0.84
61 0.79