Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067M844

Protein Details
Accession A0A067M844   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-42GPNRVKRQKIPKWVEKKIPKWBasic
65-96RIPNWVEEKKKEKKNKTKTKSRQKNTMIPARSHydrophilic
NLS Segment(s)
PositionSequence
25-101RVKRQKIPKWVEKKIPKWDEGKGSRINGSKAKDPEMGRKQRIPNWVEEKKKEKKNKTKTKSRQKNTMIPARSKKVSK
Subcellular Location(s) mito 20, nucl 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MRVRVRVRSMIINISTCLHTIGPNRVKRQKIPKWVEKKIPKWDEGKGSRINGSKAKDPEMGRKQRIPNWVEEKKKEKKNKTKTKSRQKNTMIPARSKKVSKNIKGLILIVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.23
4 0.21
5 0.15
6 0.16
7 0.18
8 0.27
9 0.33
10 0.39
11 0.47
12 0.53
13 0.57
14 0.62
15 0.69
16 0.68
17 0.7
18 0.73
19 0.75
20 0.77
21 0.8
22 0.82
23 0.8
24 0.79
25 0.79
26 0.74
27 0.68
28 0.62
29 0.58
30 0.58
31 0.52
32 0.5
33 0.43
34 0.4
35 0.4
36 0.38
37 0.37
38 0.32
39 0.31
40 0.31
41 0.29
42 0.31
43 0.32
44 0.31
45 0.38
46 0.43
47 0.48
48 0.45
49 0.5
50 0.51
51 0.51
52 0.57
53 0.49
54 0.48
55 0.5
56 0.54
57 0.54
58 0.56
59 0.6
60 0.62
61 0.69
62 0.71
63 0.73
64 0.76
65 0.81
66 0.86
67 0.88
68 0.9
69 0.92
70 0.93
71 0.93
72 0.9
73 0.9
74 0.86
75 0.85
76 0.83
77 0.81
78 0.76
79 0.74
80 0.75
81 0.71
82 0.69
83 0.64
84 0.63
85 0.63
86 0.68
87 0.67
88 0.69
89 0.67
90 0.67
91 0.64