Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NCU9

Protein Details
Accession A0A067NCU9   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
189-210APSSPVSEEKKRPQKPRAVSVDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 8, cyto 5.5, plas 5, cyto_nucl 4.5, nucl 2.5, mito 2, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028945  Get1  
IPR027538  Get1_fungi  
IPR029012  Helix_hairpin_bin_sf  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0043529  C:GET complex  
GO:0071816  P:tail-anchored membrane protein insertion into ER membrane  
Pfam View protein in Pfam  
PF04420  CHD5  
Amino Acid Sequences MDLLFTIFLLVFVTELISWVGQSVLHDSACAVYLRLFYSSTVSKQNELKASILASKQELLQTSSQDQFAKWAKLRRKVDKGLADLERINSELASARTKFGVQFKTGLWLLTGGAQFFVGWWYRKQPVFFLPPKWLGPATWWLALPWAPKGSVSCSAWQMACRRVIKVLEGTVREFVPQVSPVENEASSAPSSPVSEEKKRPQKPRAVSVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.06
5 0.06
6 0.06
7 0.07
8 0.06
9 0.07
10 0.1
11 0.11
12 0.11
13 0.11
14 0.11
15 0.11
16 0.13
17 0.12
18 0.09
19 0.08
20 0.1
21 0.11
22 0.12
23 0.12
24 0.11
25 0.15
26 0.17
27 0.19
28 0.25
29 0.26
30 0.28
31 0.31
32 0.36
33 0.36
34 0.35
35 0.33
36 0.26
37 0.26
38 0.26
39 0.24
40 0.2
41 0.17
42 0.15
43 0.15
44 0.16
45 0.16
46 0.15
47 0.16
48 0.17
49 0.19
50 0.2
51 0.21
52 0.19
53 0.18
54 0.21
55 0.23
56 0.26
57 0.27
58 0.33
59 0.38
60 0.47
61 0.56
62 0.59
63 0.63
64 0.63
65 0.67
66 0.66
67 0.61
68 0.58
69 0.51
70 0.44
71 0.36
72 0.32
73 0.24
74 0.19
75 0.16
76 0.09
77 0.08
78 0.09
79 0.09
80 0.12
81 0.12
82 0.11
83 0.12
84 0.12
85 0.14
86 0.17
87 0.18
88 0.16
89 0.17
90 0.17
91 0.2
92 0.2
93 0.18
94 0.13
95 0.11
96 0.1
97 0.11
98 0.11
99 0.07
100 0.07
101 0.07
102 0.07
103 0.06
104 0.08
105 0.06
106 0.08
107 0.09
108 0.12
109 0.17
110 0.19
111 0.19
112 0.21
113 0.24
114 0.31
115 0.33
116 0.33
117 0.34
118 0.35
119 0.35
120 0.34
121 0.3
122 0.22
123 0.21
124 0.23
125 0.21
126 0.19
127 0.18
128 0.16
129 0.17
130 0.19
131 0.17
132 0.14
133 0.13
134 0.11
135 0.12
136 0.13
137 0.16
138 0.2
139 0.21
140 0.21
141 0.22
142 0.23
143 0.24
144 0.26
145 0.26
146 0.24
147 0.3
148 0.29
149 0.28
150 0.3
151 0.3
152 0.3
153 0.3
154 0.31
155 0.29
156 0.3
157 0.3
158 0.28
159 0.27
160 0.25
161 0.21
162 0.17
163 0.14
164 0.14
165 0.14
166 0.14
167 0.15
168 0.16
169 0.19
170 0.18
171 0.17
172 0.15
173 0.16
174 0.15
175 0.15
176 0.14
177 0.12
178 0.13
179 0.14
180 0.21
181 0.26
182 0.33
183 0.41
184 0.51
185 0.61
186 0.69
187 0.77
188 0.79
189 0.82
190 0.83