Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QR05

Protein Details
Accession B6QR05    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-109RVYHQRCKSCKRLSRPKLNETYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027377  ZAR1/RTP1-5-like_Znf-3CxxC  
KEGG tmf:PMAA_045560  -  
Pfam View protein in Pfam  
PF13695  zf-3CxxC  
Amino Acid Sequences MPTKKPKSIQQWSMYPSLHEHVVRLLEEDDLHLNFYESDESETCDETWDTNVTGRFVYRNPSCGVNAWTSGRIAVTIRLYTGGKYNVRVYHQRCKSCKRLSRPKLNETYAERTAYRIKNWHGIEQEARPHSGNSNGPHNSELCEGCGAPDSAELTNHLIHEGDLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.52
3 0.45
4 0.38
5 0.35
6 0.28
7 0.24
8 0.21
9 0.23
10 0.22
11 0.2
12 0.18
13 0.14
14 0.14
15 0.15
16 0.14
17 0.12
18 0.13
19 0.11
20 0.11
21 0.1
22 0.11
23 0.1
24 0.09
25 0.12
26 0.11
27 0.13
28 0.14
29 0.15
30 0.14
31 0.14
32 0.14
33 0.11
34 0.13
35 0.12
36 0.11
37 0.13
38 0.14
39 0.13
40 0.13
41 0.13
42 0.13
43 0.12
44 0.19
45 0.17
46 0.19
47 0.2
48 0.22
49 0.22
50 0.22
51 0.24
52 0.18
53 0.19
54 0.18
55 0.17
56 0.15
57 0.14
58 0.12
59 0.1
60 0.09
61 0.09
62 0.09
63 0.08
64 0.08
65 0.09
66 0.1
67 0.1
68 0.12
69 0.14
70 0.13
71 0.15
72 0.18
73 0.19
74 0.22
75 0.29
76 0.31
77 0.37
78 0.43
79 0.49
80 0.51
81 0.56
82 0.62
83 0.65
84 0.68
85 0.68
86 0.73
87 0.75
88 0.81
89 0.82
90 0.81
91 0.79
92 0.73
93 0.69
94 0.63
95 0.61
96 0.52
97 0.47
98 0.38
99 0.33
100 0.38
101 0.35
102 0.32
103 0.31
104 0.31
105 0.37
106 0.39
107 0.42
108 0.36
109 0.37
110 0.38
111 0.36
112 0.4
113 0.34
114 0.34
115 0.29
116 0.28
117 0.26
118 0.29
119 0.3
120 0.26
121 0.33
122 0.33
123 0.34
124 0.34
125 0.33
126 0.3
127 0.28
128 0.25
129 0.18
130 0.18
131 0.16
132 0.15
133 0.18
134 0.15
135 0.12
136 0.13
137 0.14
138 0.13
139 0.14
140 0.15
141 0.15
142 0.16
143 0.16
144 0.15
145 0.13