Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067N1Y5

Protein Details
Accession A0A067N1Y5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-29GSSHSSPFRRNHRDVRKEKRRAKGPVVGBasic
NLS Segment(s)
PositionSequence
11-25RNHRDVRKEKRRAKG
Subcellular Location(s) nucl 18, cyto_nucl 13, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MGSSHSSPFRRNHRDVRKEKRRAKGPVVGSNASGQRTMPNISWPIPDITTSAPDSNTDQYHHHHHHHNHHGAPAGPDTGSAAHGGGVVHHDTSQGYSGGDTSASASYGYSGGDASASASSGDTGGGGGAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.88
4 0.88
5 0.9
6 0.9
7 0.9
8 0.88
9 0.85
10 0.83
11 0.8
12 0.76
13 0.74
14 0.71
15 0.62
16 0.53
17 0.49
18 0.44
19 0.36
20 0.29
21 0.2
22 0.16
23 0.17
24 0.18
25 0.15
26 0.16
27 0.18
28 0.19
29 0.2
30 0.19
31 0.19
32 0.17
33 0.16
34 0.14
35 0.12
36 0.13
37 0.14
38 0.13
39 0.12
40 0.13
41 0.14
42 0.16
43 0.16
44 0.15
45 0.15
46 0.17
47 0.23
48 0.26
49 0.28
50 0.32
51 0.36
52 0.43
53 0.5
54 0.52
55 0.46
56 0.44
57 0.42
58 0.35
59 0.31
60 0.24
61 0.16
62 0.11
63 0.1
64 0.09
65 0.08
66 0.08
67 0.06
68 0.05
69 0.05
70 0.06
71 0.06
72 0.05
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.08
80 0.09
81 0.08
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.06
88 0.07
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.08
95 0.07
96 0.06
97 0.06
98 0.05
99 0.05
100 0.05
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07
108 0.07
109 0.05
110 0.05