Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MK64

Protein Details
Accession A0A067MK64   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-87TYPVERCLRTPRRRRVCRDPVRFKKLTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 11, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MNSSVVTADSLCAPSRRRIAPFCPELASLPRMPRLEKLCRGVSSAPPPVTHNVPVVLPVTYPVERCLRTPRRRRVCRDPVRFKKLTSLESLLLAAAASDDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.3
3 0.34
4 0.38
5 0.41
6 0.46
7 0.51
8 0.52
9 0.48
10 0.44
11 0.4
12 0.37
13 0.35
14 0.32
15 0.26
16 0.24
17 0.27
18 0.26
19 0.26
20 0.3
21 0.32
22 0.36
23 0.39
24 0.42
25 0.41
26 0.4
27 0.42
28 0.38
29 0.36
30 0.34
31 0.34
32 0.3
33 0.26
34 0.27
35 0.27
36 0.26
37 0.23
38 0.18
39 0.14
40 0.13
41 0.13
42 0.12
43 0.1
44 0.08
45 0.07
46 0.1
47 0.1
48 0.11
49 0.12
50 0.16
51 0.16
52 0.18
53 0.28
54 0.35
55 0.45
56 0.55
57 0.63
58 0.7
59 0.79
60 0.86
61 0.87
62 0.87
63 0.88
64 0.89
65 0.9
66 0.89
67 0.89
68 0.82
69 0.72
70 0.71
71 0.65
72 0.57
73 0.52
74 0.46
75 0.38
76 0.37
77 0.36
78 0.26
79 0.2
80 0.17
81 0.1
82 0.06