Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067N2C0

Protein Details
Accession A0A067N2C0   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
187-215EVFVEHLPTKKKRKLWRRKDMKFEYPYKEBasic
NLS Segment(s)
PositionSequence
196-205KKKRKLWRRK
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 9, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009446  Mgm101  
Gene Ontology GO:0000262  C:mitochondrial chromosome  
GO:0003697  F:single-stranded DNA binding  
GO:0006281  P:DNA repair  
GO:0000002  P:mitochondrial genome maintenance  
Pfam View protein in Pfam  
PF06420  Mgm101p  
Amino Acid Sequences MPPQSTTAPKTATQAPASQNGASASEASPLIEQTSDGSLPTLGDDWSRSYFGLSTQPFSAEIAEILQAPLDPEDVEMKPDGIIYLPEIKYRRILNKAFGPGGWGLAPRSETNVGPSVVSREYALVCLGRLVSVARGEQDYFNPAGIPTATEGCKSNALMRCCKDIGIASELWDPRFIREFKAKYCAEVFVEHLPTKKKRKLWRRKDMKFEYPYKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.41
4 0.42
5 0.38
6 0.33
7 0.28
8 0.27
9 0.22
10 0.2
11 0.14
12 0.13
13 0.13
14 0.12
15 0.12
16 0.11
17 0.11
18 0.09
19 0.09
20 0.08
21 0.11
22 0.1
23 0.1
24 0.1
25 0.09
26 0.09
27 0.1
28 0.09
29 0.07
30 0.08
31 0.09
32 0.11
33 0.13
34 0.14
35 0.13
36 0.13
37 0.13
38 0.14
39 0.21
40 0.19
41 0.19
42 0.19
43 0.2
44 0.19
45 0.19
46 0.18
47 0.1
48 0.09
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.05
60 0.08
61 0.08
62 0.1
63 0.09
64 0.09
65 0.09
66 0.09
67 0.08
68 0.05
69 0.06
70 0.06
71 0.12
72 0.12
73 0.16
74 0.17
75 0.18
76 0.21
77 0.24
78 0.28
79 0.29
80 0.3
81 0.31
82 0.36
83 0.38
84 0.34
85 0.31
86 0.28
87 0.21
88 0.2
89 0.15
90 0.1
91 0.07
92 0.08
93 0.09
94 0.07
95 0.09
96 0.1
97 0.1
98 0.12
99 0.14
100 0.14
101 0.12
102 0.13
103 0.13
104 0.11
105 0.12
106 0.09
107 0.08
108 0.08
109 0.08
110 0.09
111 0.06
112 0.06
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.06
119 0.06
120 0.07
121 0.07
122 0.08
123 0.09
124 0.1
125 0.1
126 0.12
127 0.12
128 0.11
129 0.11
130 0.1
131 0.1
132 0.09
133 0.09
134 0.07
135 0.09
136 0.1
137 0.11
138 0.12
139 0.13
140 0.15
141 0.15
142 0.21
143 0.24
144 0.28
145 0.33
146 0.34
147 0.37
148 0.36
149 0.35
150 0.3
151 0.26
152 0.25
153 0.22
154 0.2
155 0.18
156 0.23
157 0.24
158 0.23
159 0.24
160 0.21
161 0.2
162 0.27
163 0.25
164 0.26
165 0.34
166 0.38
167 0.39
168 0.47
169 0.44
170 0.41
171 0.42
172 0.4
173 0.33
174 0.3
175 0.29
176 0.26
177 0.31
178 0.29
179 0.31
180 0.35
181 0.41
182 0.5
183 0.54
184 0.57
185 0.63
186 0.73
187 0.8
188 0.84
189 0.87
190 0.89
191 0.91
192 0.94
193 0.92
194 0.91
195 0.89