Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067M8M8

Protein Details
Accession A0A067M8M8   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
74-93PAMGRPSKPVRRKSHHSRASBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001683  PX_dom  
IPR036871  PX_dom_sf  
IPR037917  Ypt35_PX  
Gene Ontology GO:0010008  C:endosome membrane  
GO:0005774  C:vacuolar membrane  
GO:0032266  F:phosphatidylinositol-3-phosphate binding  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF00787  PX  
PROSITE View protein in PROSITE  
PS50195  PX  
CDD cd07280  PX_YPT35  
Amino Acid Sequences MSTVSTPSSPSSPSSPLLPCTPTFPEYSAPSHPFQNTNELITVIPKSTSDLITEESQLYDEFPSDDESTPVTPPAMGRPSKPVRRKSHHSRASVDSRSVFSNDIFLSNNLGESRAFARRVTVPGWTSVGDKLGAAYIVYDCAIVTKDGTTIHALKRYSAFEQLHTSLMLSLPRYLLPQIPRLPPKSALSRYRPSFLARRRRNLEQWLSAILLHPEVGASKAVRVWLME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.3
4 0.32
5 0.32
6 0.28
7 0.3
8 0.33
9 0.3
10 0.29
11 0.28
12 0.29
13 0.29
14 0.33
15 0.34
16 0.34
17 0.33
18 0.36
19 0.36
20 0.35
21 0.34
22 0.37
23 0.32
24 0.3
25 0.29
26 0.26
27 0.23
28 0.22
29 0.21
30 0.13
31 0.12
32 0.1
33 0.12
34 0.13
35 0.14
36 0.13
37 0.14
38 0.16
39 0.17
40 0.18
41 0.16
42 0.14
43 0.14
44 0.13
45 0.12
46 0.09
47 0.08
48 0.07
49 0.07
50 0.11
51 0.12
52 0.12
53 0.12
54 0.13
55 0.14
56 0.14
57 0.14
58 0.1
59 0.09
60 0.09
61 0.13
62 0.18
63 0.18
64 0.18
65 0.27
66 0.36
67 0.45
68 0.52
69 0.57
70 0.61
71 0.68
72 0.76
73 0.78
74 0.8
75 0.8
76 0.76
77 0.71
78 0.68
79 0.68
80 0.6
81 0.51
82 0.42
83 0.35
84 0.31
85 0.27
86 0.22
87 0.13
88 0.14
89 0.12
90 0.12
91 0.11
92 0.1
93 0.11
94 0.1
95 0.11
96 0.08
97 0.09
98 0.07
99 0.08
100 0.1
101 0.11
102 0.12
103 0.11
104 0.13
105 0.14
106 0.17
107 0.16
108 0.16
109 0.14
110 0.15
111 0.16
112 0.15
113 0.14
114 0.12
115 0.12
116 0.1
117 0.09
118 0.08
119 0.07
120 0.06
121 0.05
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.06
135 0.08
136 0.11
137 0.13
138 0.15
139 0.19
140 0.19
141 0.2
142 0.23
143 0.24
144 0.23
145 0.27
146 0.26
147 0.24
148 0.29
149 0.29
150 0.27
151 0.24
152 0.22
153 0.15
154 0.16
155 0.15
156 0.11
157 0.1
158 0.1
159 0.1
160 0.12
161 0.12
162 0.16
163 0.17
164 0.24
165 0.28
166 0.35
167 0.41
168 0.43
169 0.46
170 0.45
171 0.48
172 0.5
173 0.53
174 0.54
175 0.55
176 0.61
177 0.61
178 0.6
179 0.57
180 0.53
181 0.55
182 0.55
183 0.59
184 0.59
185 0.65
186 0.68
187 0.75
188 0.77
189 0.77
190 0.76
191 0.7
192 0.64
193 0.56
194 0.5
195 0.42
196 0.36
197 0.27
198 0.2
199 0.14
200 0.11
201 0.09
202 0.09
203 0.1
204 0.11
205 0.1
206 0.11
207 0.12
208 0.14