Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MW73

Protein Details
Accession A0A067MW73    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-26LKPLGCPCSRRARRRSLTTNYYGHydrophilic
69-94IIESRPCPGRRRSKRCNPRLPSAYRDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPELKPLGCPCSRRARRRSLTTNYYGLLWIDRADRCIRLMSHTPRRAQGFIGRCPSPVLVQVYTFLLKIIESRPCPGRRRSKRCNPRLPSAYRDSGERPHVLVTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.73
4 0.81
5 0.84
6 0.82
7 0.8
8 0.75
9 0.7
10 0.59
11 0.5
12 0.41
13 0.32
14 0.23
15 0.16
16 0.12
17 0.12
18 0.12
19 0.14
20 0.15
21 0.15
22 0.16
23 0.18
24 0.17
25 0.19
26 0.27
27 0.33
28 0.41
29 0.46
30 0.47
31 0.48
32 0.5
33 0.46
34 0.39
35 0.37
36 0.32
37 0.32
38 0.34
39 0.3
40 0.27
41 0.28
42 0.26
43 0.2
44 0.19
45 0.17
46 0.13
47 0.13
48 0.13
49 0.14
50 0.14
51 0.13
52 0.1
53 0.07
54 0.07
55 0.08
56 0.1
57 0.14
58 0.15
59 0.19
60 0.26
61 0.32
62 0.37
63 0.45
64 0.54
65 0.59
66 0.68
67 0.75
68 0.8
69 0.85
70 0.9
71 0.92
72 0.88
73 0.87
74 0.86
75 0.81
76 0.77
77 0.73
78 0.69
79 0.59
80 0.57
81 0.5
82 0.47
83 0.47
84 0.42
85 0.36